DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11550 and SFH5

DIOPT Version :9

Sequence 1:NP_651882.1 Gene:CG11550 / 43731 FlyBaseID:FBgn0039864 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_012390.1 Gene:SFH5 / 853296 SGDID:S000003681 Length:294 Species:Saccharomyces cerevisiae


Alignment Length:278 Identity:61/278 - (21%)
Similarity:99/278 - (35%) Gaps:82/278 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 YASFPE-IRRPEVLKFLDWIHAQPHISDRFSEGEALHFFHACR-YSMEVAKQVLDTNLTARTHLE 72
            |...|| :.:.||.|:.|     ..|:||.:       :..|: |..|.:..|  .||....:..
Yeast    36 YKLNPEGLTQEEVDKYYD-----EKIADRLT-------YKLCKAYQFEYSTIV--QNLIDILNWR 86

  Fly    73 EFFVNLDCERPEIRRA-MRTVSIVPLPG---ATPEG------------------------YRVIL 109
            ..|..|.|...|:... ::.|.|:....   |..:.                        ||:.|
Yeast    87 REFNPLSCAYKEVHNTELQNVGILTFDANGDANKKAVTWNLYGQLVKKKELFQNVDKFVRYRIGL 151

  Fly   110 AK----LDDLNTSNYNFADVMKLYCMVFDFWMYEDGIQPGHVIVIDLKNTSLGHVARIGLLQMKK 170
            .:    |.|..:|:.|:...:..|..| ..|..:.          |:||.|   ...||:.|.  
Yeast   152 MEKGLSLLDFTSSDNNYMTQVHDYKGV-SVWRMDS----------DIKNCS---KTVIGIFQK-- 200

  Fly   171 FLYYLQEAAAIRLIGFHFINIVPFMDKILALMTPFMKKELTT-----VLHMHSDLKEFYKFVPQE 230
              ||.:     .|...:|:|:......:..|:..|:.:  ||     ||...|.|.::.|..|.|
Yeast   201 --YYPE-----LLYAKYFVNVPTVFGWVYDLIKKFVDE--TTRKKFVVLTDGSKLGQYLKDCPYE 256

  Fly   231 MLPKEYGGQLEEANVAKE 248
                .|||:.::.|:.|:
Yeast   257 ----GYGGKDKKNNLTKQ 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11550NP_651882.1 CRAL_TRIO 94..239 CDD:279044 37/180 (21%)
SFH5NP_012390.1 SEC14 101..263 CDD:214706 39/190 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.