DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11550 and AT1G30690

DIOPT Version :9

Sequence 1:NP_651882.1 Gene:CG11550 / 43731 FlyBaseID:FBgn0039864 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_001031119.1 Gene:AT1G30690 / 839949 AraportID:AT1G30690 Length:540 Species:Arabidopsis thaliana


Alignment Length:187 Identity:43/187 - (22%)
Similarity:78/187 - (41%) Gaps:46/187 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 FWMYEDGIQ-----PGHVI----VIDLKNTSLGHVARIGL-LQMKKFLYYLQEAAAIRLIGFHFI 189
            |.:.|.|||     ||.|.    :.||||..  .|:|..: :.:||.:..||:.....:....||
plant   308 FQLMEKGIQKLNLKPGGVTSLLQIHDLKNAP--GVSRTEIWVGIKKVIETLQDNYPEFVSRNIFI 370

  Fly   190 NIVPFMDKILALMTPFMKKELTT--VLHMHSDLKE-FYKFVPQEMLPKEYGGQLEEANVAKEIYY 251
            |:..:...:.|:::||:.:...:  |:...:.::| ..|::|.:.||.:|||            :
plant   371 NVPFWFYAMRAVLSPFLTQRTKSKFVVARPAKVRETLLKYIPADELPVQYGG------------F 423

  Fly   252 KKLLDNRKEMIEFETRHQVNEKLRPGKAKNAS--------------DLFGIEGNFKK 294
            |.:.|.     ||.........::||.::...              .:.|.|.|:|:
plant   424 KTVDDT-----EFSNETVSEVVVKPGSSETIEIPAPETEGTLVWDIAVLGWEVNYKE 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11550NP_651882.1 CRAL_TRIO 94..239 CDD:279044 32/116 (28%)
AT1G30690NP_001031119.1 CRAL_TRIO_N <219..244 CDD:215024
SEC14 273..422 CDD:214706 31/115 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.