DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11550 and TTPAL

DIOPT Version :9

Sequence 1:NP_651882.1 Gene:CG11550 / 43731 FlyBaseID:FBgn0039864 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_001034288.1 Gene:TTPAL / 79183 HGNCID:16114 Length:342 Species:Homo sapiens


Alignment Length:237 Identity:65/237 - (27%)
Similarity:107/237 - (45%) Gaps:7/237 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PEIRRPEVLKFLDWIHAQ-PHISDRFSEGEALHFFHACRYSMEVAKQVLDTNLTARTHLEEFFVN 77
            ||.|..:|....|.:..: |::|....:...|.|..|.::..:.|.|:|....:.|....|.|.|
Human    51 PEWRLRDVQALRDMVRKEYPNLSTSLDDAFLLRFLRARKFDYDRALQLLVNYHSCRRSWPEVFNN 115

  Fly    78 LDCERPE-IRRAMRTVSIVPLPGATPEGYRVILAKLDDLNTSNYNFAD-VMKLYCMVFDFWMYED 140
            |   :|. ::..:.:..:..||...|.|..|:..:.|....|||...: :..:|..:......|:
Human   116 L---KPSALKDVLASGFLTVLPHTDPRGCHVVCIRPDRWIPSNYPITENIRAIYLTLEKLIQSEE 177

  Fly   141 GIQPGHVIVIDLKNTSLGHVARIGLLQMKKFLYYLQEAAAIRLIGFHFINIVPFMDKILALMTPF 205
            ....|.||:.|.|..||...:..|....||.:..||:...||:...|.:|.......|.|::.||
Human   178 TQVNGIVILADYKGVSLSKASHFGPFIAKKVIGILQDGFPIRIKAVHVVNEPRIFKGIFAIIKPF 242

  Fly   206 MKKELTTVLHMH-SDLKEFYKFVPQEMLPKEYGGQLEEANVA 246
            :|:::.....:| |||...:..:|:.:|||||||...|.:.|
Human   243 LKEKIANRFFLHGSDLNSLHTNLPRSILPKEYGGTAGELDTA 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11550NP_651882.1 CRAL_TRIO 94..239 CDD:279044 43/146 (29%)
TTPALNP_001034288.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
CRAL_TRIO_N 56..102 CDD:215024 10/45 (22%)
SEC14 121..277 CDD:238099 43/155 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.