DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11550 and Sec14l1

DIOPT Version :9

Sequence 1:NP_651882.1 Gene:CG11550 / 43731 FlyBaseID:FBgn0039864 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_083053.2 Gene:Sec14l1 / 74136 MGIID:1921386 Length:719 Species:Mus musculus


Alignment Length:292 Identity:52/292 - (17%)
Similarity:109/292 - (37%) Gaps:67/292 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VLKFLDWIHAQPHISDRFSEGEALHFFHACRYSMEVAKQVLDTNLTARTHLEEFFVNLDCERPEI 85
            :::...|:. :.|......:...|.|..|..::::.|::::..:||.|...:..:: ||...|. 
Mouse   259 LIRLRQWLQ-ETHKGKIPKDEHILRFLRARDFNIDKAREIMCQSLTWRKQHQVDYI-LDTWTPP- 320

  Fly    86 RRAMRTVSIVPLPGA----TPEGYRVILAKLDDLNTSNYNFA---DVMKLYCMVFDFWMYEDGIQ 143
                 .|.:....|.    ..:|..:.:.:|..::|.....|   :.:..|.:..:    |:|::
Mouse   321 -----QVLLDYYAGGWHHHDKDGRPLYVLRLGQMDTKGLVRALGEEALLRYVLSIN----EEGLR 376

  Fly   144 P--------GHVI-----VIDLKNTSLGHVARIGLLQMKKFLYYLQEAAAIRLIGFHFINIVPFM 195
            .        |..|     ::||:..::.|:.|.|:            .|.:|:|.....|....:
Mouse   377 RCEENTKVFGRPISSWTCLVDLEGLNMRHLWRPGV------------KALLRIIEVVEANYPETL 429

  Fly   196 DKILALMTPFMKKELTTVLHMHSDLKEFYKF-----------------VPQEMLPKEYGGQL--- 240
            .::|.|..|.:...|.|::....|.....||                 :.:|::|....|:.   
Mouse   430 GRLLILRAPRVFPVLWTLVSPFIDDNTRRKFLIYAGNDYQGPGGLLDYIDKEIIPDFLSGECMCD 494

  Fly   241 --EEANVAKEIY-YKKLLDNRKEMIEFETRHQ 269
              |...|.|.:| ..:.|:|....:..||.:|
Mouse   495 VPEGGLVPKSLYRTAEELENEDLKLWTETIYQ 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11550NP_651882.1 CRAL_TRIO 94..239 CDD:279044 29/181 (16%)
Sec14l1NP_083053.2 Required for interaction and inhibitory function toward DDX58. /evidence=ECO:0000250|UniProtKB:Q92503 1..510 47/274 (17%)
PRELI 17..173 CDD:282550
CRAL_TRIO_N 256..301 CDD:215024 6/42 (14%)
CRAL_TRIO 326..490 CDD:279044 29/179 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.