DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11550 and Sec14l2

DIOPT Version :9

Sequence 1:NP_651882.1 Gene:CG11550 / 43731 FlyBaseID:FBgn0039864 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_653103.1 Gene:Sec14l2 / 67815 MGIID:1915065 Length:403 Species:Mus musculus


Alignment Length:171 Identity:36/171 - (21%)
Similarity:65/171 - (38%) Gaps:33/171 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 IVIDLKNTSLGHVARIGLLQMKKFLYYLQEAAAIRLIGFHFINIVPFMDKILALMTPFMKKEL-T 211
            ::.|.:...|.|:.:..:....:||...:|.....|.....:...........|:.||:.::. .
Mouse   151 MIYDCEGLGLKHLWKPAVEAYGEFLTMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRR 215

  Fly   212 TVLHMHSDLKE-FYKFVPQEMLPKEYGGQLEE--------------ANVAKEIYYKKLLDNRKEM 261
            .::.:.::.|| ..|.:..:.||.||||.:.:              .::.|:.|.:   |..|:.
Mouse   216 KIMVLGANWKEVLLKHISPDQLPVEYGGTMTDPDGNPKCKSKINYGGDIPKQYYVR---DQVKQQ 277

  Fly   262 IEFETR------HQVN-EKLRPGKA------KNASDL-FGI 288
            .|...:      |||. |.|.||..      ...||: |||
Mouse   278 YEHTVQVSRGSSHQVEYEILFPGCVLRWQFMSEGSDVGFGI 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11550NP_651882.1 CRAL_TRIO 94..239 CDD:279044 18/92 (20%)
Sec14l2NP_653103.1 CRAL_TRIO_N 13..59 CDD:215024
SEC14 76..244 CDD:214706 18/92 (20%)
GOLD_2 300..381 CDD:290608 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.