DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11550 and Sec14l3

DIOPT Version :9

Sequence 1:NP_651882.1 Gene:CG11550 / 43731 FlyBaseID:FBgn0039864 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_072130.1 Gene:Sec14l3 / 64543 RGDID:620812 Length:400 Species:Rattus norvegicus


Alignment Length:352 Identity:68/352 - (19%)
Similarity:124/352 - (35%) Gaps:123/352 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NLEDQYASFPEIRRPEVLKFLDWIHAQPHISDRFSEGEALHFFHACRYSMEVAKQVLDTNLTART 69
            |::|   ..|.:..|:....|.|:.|:   :....:.||:     .|..||..| .:|.:     
  Rat    22 NVQD---VLPALPNPDDYFLLRWLRAR---NFDLQKSEAM-----LRKYMEFRK-TMDID----- 69

  Fly    70 HLEEFFVNLDCERPEIRRAMRTVSIVPLPGA-------------------TPEGYRVILAKLDDL 115
            |:      ||.:.||:.:..       :||.                   .|:|....:.|.|.|
  Rat    70 HI------LDWQPPEVIQKY-------MPGGLCGYDRDGCPLWYDIIGPLDPKGLLFSVTKQDLL 121

  Fly   116 NTSNYNFADVMKLYCMVFDFWMYEDGIQPGH--------VIVIDLKNTSLGHVAR---------I 163
            .|   ...|..::        ::|..:|...        |::.|.:...|.|..:         .
  Rat   122 KT---KMRDCERI--------LHECDLQTERLGRKIETIVMIFDCEGLGLKHFWKPLVEVYQEFF 175

  Fly   164 GLLQMK-----KFLYYLQEAAAIRLIGFHFINIVPFMDKILALMTPFMKKEL-TTVLHMHSDLKE 222
            |||:..     ||: .:.:|..:..:|::             ||.||:.::. ..::.:.:..||
  Rat   176 GLLEENYPETLKFM-LIVKATKLFPVGYN-------------LMKPFLSEDTRRKIVVLGNSWKE 226

  Fly   223 -FYKFVPQEMLPKEYGGQLEE--------------ANVAKEIYYKKLLDNRKE---MIEFETRHQ 269
             ..|.:..|.||..:||.|.:              ..:.|.:|.:..:..:.|   .|...:.||
  Rat   227 GLLKLISPEELPAHFGGTLTDPDGNPKCLTKINYGGEIPKSMYVRDQVKTQYEHSVQISRGSSHQ 291

  Fly   270 VN-EKLRPG------KAKNASDL-FGI 288
            |. |.|.||      .:.:.:|: ||:
  Rat   292 VEYEILFPGCVLRWQFSSDGADIGFGV 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11550NP_651882.1 CRAL_TRIO 94..239 CDD:279044 33/187 (18%)
Sec14l3NP_072130.1 CRAL_TRIO_N 13..59 CDD:215024 10/47 (21%)
SEC14 76..245 CDD:214706 36/200 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.