DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11550 and RLBP1

DIOPT Version :9

Sequence 1:NP_651882.1 Gene:CG11550 / 43731 FlyBaseID:FBgn0039864 Length:298 Species:Drosophila melanogaster
Sequence 2:XP_016877949.1 Gene:RLBP1 / 6017 HGNCID:10024 Length:326 Species:Homo sapiens


Alignment Length:264 Identity:58/264 - (21%)
Similarity:118/264 - (44%) Gaps:26/264 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EDQYASFPEIRRPEVLKFLDWIHAQP--------HISDRFSE---GEALHFFHACRYSMEVAKQV 60
            :|:.....|.|...|.:..:.:.||.        .:::|..|   |..|.|..|.::::..|.::
Human    58 KDELNEREETREEAVRELQEMVQAQAASGEELAVAVAERVQEKDSGFFLRFIRARKFNVGRAYEL 122

  Fly    61 LDTNLTARTHLEEFFVNLDCERPEIRRAMRTVSIVPLPGATPE----GYRVILAKLDDLNTSNYN 121
            |...:..|....|.|.:|.   ||   |:|.......||....    |..|:|..:::..:....
Human   123 LRGYVNFRLQYPELFDSLS---PE---AVRCTIEAGYPGVLSSRDKYGRVVMLFNIENWQSQEIT 181

  Fly   122 FADVMKLYCMVFDFWMYEDGIQ-PGHVIVIDLKNTSLGHVARIGLLQMKKFLYYLQEAAAIRLIG 185
            |.::::.||.:.:..:..:..| .|..|:.:.|..::...|.:....::|.:..||::...|...
Human   182 FDEILQAYCFILEKLLENEETQINGFCIIENFKGFTMQQAASLRTSDLRKMVDMLQDSFPARFKA 246

  Fly   186 FHFINIVPFMDKILALMTPFMKKELTTVLHMH-SDLKEFYKFVPQEMLPKEYGGQLEEAN---VA 246
            .|||:...:......::.||:|.:|...:.:| .||..||:.:.:.:||.::||.|.:.:   ||
Human   247 IHFIHQPWYFTTTYNVVKPFLKSKLLERVFVHGDDLSGFYQEIDENILPSDFGGTLPKYDGKAVA 311

  Fly   247 KEIY 250
            ::::
Human   312 EQLF 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11550NP_651882.1 CRAL_TRIO 94..239 CDD:279044 32/150 (21%)
RLBP1XP_016877949.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.