DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11550 and CG33523

DIOPT Version :9

Sequence 1:NP_651882.1 Gene:CG11550 / 43731 FlyBaseID:FBgn0039864 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster


Alignment Length:146 Identity:28/146 - (19%)
Similarity:59/146 - (40%) Gaps:30/146 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 KNTSLGHVARIGLLQMKKFLYYLQEAAAIRLIGFHFINIVPFMD----KILALMTPFMKKELTTV 213
            |:.:|..:.||       .:|:::.....:    |...:..|.|    .:.::...|:|:.:.| 
  Fly   118 KSKNLDELIRI-------VVYWVERTQREQ----HLTQLTIFFDMSGTSLASMDLEFVKRIVET- 170

  Fly   214 LHMHSDLKEFYKFVPQEMLPKEYGGQLEEA-NVAKEIYYKKLLDNRKEMIEFETRHQVNEKLRPG 277
                  .|:||......:|..|.|..|..| .|.|.:...|.:    |:::..::..:|:.:   
  Fly   171 ------FKQFYPNSLNYILVYELGWVLNAAFKVIKAVLPPKAV----EILKMISKKDINQYI--- 222

  Fly   278 KAKNASDLFGIEGNFK 293
            ...|...::|.|.|::
  Fly   223 NKDNCLAIWGGEDNYE 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11550NP_651882.1 CRAL_TRIO 94..239 CDD:279044 17/89 (19%)
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044 26/140 (19%)
Motile_Sperm 293..396 CDD:279029
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.