DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11550 and Cralbp

DIOPT Version :9

Sequence 1:NP_651882.1 Gene:CG11550 / 43731 FlyBaseID:FBgn0039864 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_523939.1 Gene:Cralbp / 38651 FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster


Alignment Length:296 Identity:62/296 - (20%)
Similarity:117/296 - (39%) Gaps:15/296 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RRPEVLKFLDWIHAQPHISD-RFSEGEALHFFHACRYSMEVAKQVLDTNLTARTHLEEFFVNLDC 80
            |...:.:..:|:.....:.: |..:...|.|..|.::|:.:|:|.|...|..|.........||.
  Fly    30 REQSLEQLRNWVAKNEDLQNVRCDDTFLLRFLRAKKFSVPMAEQTLLKYLNIRRTFPHMSTQLDY 94

  Fly    81 ERPEIRRAMRTVSIVPLPGATPEGYRVILAKLDDLNTSNYNFADVMKLYCMVFDFWMYEDGIQ-P 144
            ..|.:...:....|..:|.....|.||::.....||...:...|..|.:.:.::..|.:...| .
  Fly    95 LEPRLGDLIDQGYIFAVPQRDKHGRRVVVINAKGLNPKIHTSCDQAKAHFLTYECLMEDQETQIT 159

  Fly   145 GHVIVIDLKNTSLGHVARIGLLQMKKFLYYLQEAAAIRLIGFHFINIVPFMDKILALMTPFMKKE 209
            |...|.|....:..||......:..:...:.:::..:|....|.||:...:..::..:...:..:
  Fly   160 GLTHVGDFAGVTTAHVTNWNPTEFARIFKWGEQSLPMRHKEIHLINVPSTLKWLIDFVKNRVSSK 224

  Fly   210 LTTVLHMHSDLKEFYKFVPQEMLPKEYGGQLEEANVAKEIYYKKLLDNR-------KEMIEFETR 267
            :...|.::...||..|.|.|..||.|.||::....:. |::.::|...|       |.::..:..
  Fly   225 MKNRLIIYGSEKELMKSVDQGCLPLEMGGKVPMREMI-ELWKQELATKRDLILGLDKSILRSDRG 288

  Fly   268 HQVNEKLRPGKAKN-----ASDLFGIEGNFKKLDID 298
            .|.......|||..     .|.:..|||:|:||:.|
  Fly   289 IQRRSSFNAGKASTGGPNFVSQIESIEGSFRKLEFD 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11550NP_651882.1 CRAL_TRIO 94..239 CDD:279044 30/145 (21%)
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024 9/46 (20%)
SEC14 101..254 CDD:238099 30/152 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.