DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11550 and CG12926

DIOPT Version :9

Sequence 1:NP_651882.1 Gene:CG11550 / 43731 FlyBaseID:FBgn0039864 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster


Alignment Length:300 Identity:90/300 - (30%)
Similarity:147/300 - (49%) Gaps:7/300 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KEANLEDQYASFPEIRRPEVLKFLDWIHAQPHISDRFSEGEALHFFHACRYSMEVAKQVLDTNLT 66
            |:|:  |:....|:....::.....||..|||:..|......:.|...|:||:|..|..||....
  Fly    18 KKAH--DELGEIPDRIDEDIETLRTWISKQPHLKARQDAQFLVAFLRGCKYSLEKTKLKLDNFYA 80

  Fly    67 ARTHLEEFFVNLDCERPEIRRAMRTVSIVPLP-GATPEGYRVILAKLDDLNTSNYNFADVMKLYC 130
            .|..:.|.:.|......:: ..:.|..::.|| ....:|.|:.:::....::..|:.|:|:::..
  Fly    81 MRGAVPELYKNRIVGEKQL-SILDTGCLLRLPQPLQADGPRIHISRYGQYDSKKYSIAEVVQVNT 144

  Fly   131 MVFDFWMYED--GIQPGHVIVIDLKNTSLGHVARIGLLQMKKFLYYLQEAAAIRLIGFHFINIVP 193
            |:.:..:.||  .:..|.|.:||:|....||:.:...:.:||......:|...|..||||:|...
  Fly   145 MLGEIQIREDDNAMISGFVEIIDMKGVGAGHLFQFDAVLVKKLAVLGDKAYPYRPKGFHFVNAPS 209

  Fly   194 FMDKILALMTPFMKKELTTVLHMHSDLKEFYKFVPQEMLPKEYGGQLEEANVAKEIYYKKLLDNR 258
            ..:|.:::....|.:::....|:||.|...||:||:|.||.||||...........:..||| ..
  Fly   210 SAEKFMSIAKSLMSEKIRKRFHIHSKLDSLYKYVPKECLPAEYGGSNGTIQDVVSTWRTKLL-AY 273

  Fly   259 KEMIEFETRHQVNEKLRPGKAKNASDLFGIEGNFKKLDID 298
            |...|.|..:..|||||.|:..:|..||||||:|:|||||
  Fly   274 KPFFEEEASYGTNEKLRRGQPVSAESLFGIEGSFRKLDID 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11550NP_651882.1 CRAL_TRIO 94..239 CDD:279044 42/147 (29%)
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 13/44 (30%)
SEC14 117..254 CDD:238099 39/136 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.