DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11550 and CG1902

DIOPT Version :9

Sequence 1:NP_651882.1 Gene:CG11550 / 43731 FlyBaseID:FBgn0039864 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_610507.1 Gene:CG1902 / 35993 FlyBaseID:FBgn0033434 Length:312 Species:Drosophila melanogaster


Alignment Length:308 Identity:72/308 - (23%)
Similarity:124/308 - (40%) Gaps:32/308 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EDQYASFPEIRRPEVLKFLDWIHAQPHISDRFSEGEALHFFHACRYSMEVAKQVLDTNLTARTHL 71
            ||..::..:|   |.|:  .||..|.::..|..:...:.|...||:.:|.||:.:....|.::..
  Fly    21 EDPSSTVAKI---EALR--TWIDKQIYLEARTDDQFLVAFLRFCRWDVEEAKKRVLFYYTYKSKE 80

  Fly    72 EEFFVNLDCERPEIRRAMRTV-SIVPLPGATPEGYRVILAKLDDLNTSNYNFADVMKLYCM---- 131
            .|.......:...|..|...: :.:|.| ..|.|.|:...::..:..|.::.:|:.:.:..    
  Fly    81 RELLKGRQVDDKLIELARSGIFATLPKP-IGPGGPRIHYTRMGHIEPSKHSVSDIFRFHAFRAEI 144

  Fly   132 ---VFDFWMYEDGIQPGHVIVIDLKNTSLGHVARIGLLQMKKFLYYLQEAAAIRLIGFHFINIVP 193
               ..|.|..     .|.|.:||........:.:......|:...:|:......|:..|.:|...
  Fly   145 EINTDDNWNI-----AGVVEIIDFTKIPYSLLLQFDPGMFKRMNAFLEHGIPANLVATHIVNASR 204

  Fly   194 FMDKILALMTPFMK-KELTTVLHMHSDLKEFYKFVPQEMLPKEYGGQLEEANVAKEIYYKKLLDN 257
            ....:|.|:...|| |||   ||:||.:....|.:..|.||.|.||.....:.|...|..:||..
  Fly   205 ETQFVLGLVRNVMKQKEL---LHIHSTVASLRKAIGLEYLPVEMGGDNGSLSDAMTRYETQLLSF 266

  Fly   258 RKEMIEFETRHQVNEKLRPGKAKN-------ASDLFGIEGNFKKLDID 298
            .....|.| |:.|:||||....|:       .:|:.. :|.|:.::.|
  Fly   267 SPYFTEDE-RYGVDEKLREASEKDQERGAPLVTDVPN-DGTFRMINFD 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11550NP_651882.1 CRAL_TRIO 94..239 CDD:279044 35/152 (23%)
CG1902NP_610507.1 CRAL_TRIO_N 28..69 CDD:215024 13/45 (29%)
CRAL_TRIO 100..248 CDD:279044 35/156 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.