DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11550 and CG10237

DIOPT Version :9

Sequence 1:NP_651882.1 Gene:CG11550 / 43731 FlyBaseID:FBgn0039864 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_609967.1 Gene:CG10237 / 35222 FlyBaseID:FBgn0032783 Length:324 Species:Drosophila melanogaster


Alignment Length:231 Identity:50/231 - (21%)
Similarity:100/231 - (43%) Gaps:18/231 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LHFFHACRYSMEVAKQVLDTNLTARTHLEEFFVNLDCERPE-----IRRAMRTVSIVPLPGATPE 103
            :.:...|:|..|.|:.::......:....:.:.:|   :|.     .:..:.||    .|.....
  Fly    95 IRYLRPCKYYPESARDLIKRYYAFKVKHADVYTDL---KPSNEANIFKHNILTV----FPNRDQL 152

  Fly   104 GYRVILAKLDD-LNTSNYNFADVMKLYCMVFDFWMYEDGIQ-PGHVIVIDLKNTSLGHVARIGLL 166
            |.|:::.:|.. .........:|.|...:..:..|.|...| .|.|::.|:...||....:....
  Fly   153 GRRILVLELGKRWKHKQVTLDEVFKGAVLFLEAAMLEPETQICGAVVIFDMDGLSLQQTWQFTPP 217

  Fly   167 QMKKFLYYLQEAAAIRLIGFHFINIVPFMDKILALMTPFMKKELTTVLHMH-SDLKEFYKFVPQE 230
            ..|:.:.:||::..:|:...|.:|.......:.||..||:|::|.:.:..| :|.:..:|::..:
  Fly   218 FAKRIVDWLQDSVPLRIKAIHIVNQPKIFQVVFALFKPFLKEKLRSRIIFHGTDRESLHKYMSPK 282

  Fly   231 MLPKEYGGQLEEANVAKEIYYKKLLDNRKEMIEFET 266
            .||..|||..|.:.:..:.:|:.||   |...||:|
  Fly   283 CLPAAYGGFREASRIDSDQWYQLLL---KCDTEFDT 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11550NP_651882.1 CRAL_TRIO 94..239 CDD:279044 33/147 (22%)
CG10237NP_609967.1 CRAL_TRIO_N 68..115 CDD:215024 4/19 (21%)
SEC14 137..290 CDD:238099 34/156 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.