DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11550 and Ku80

DIOPT Version :9

Sequence 1:NP_651882.1 Gene:CG11550 / 43731 FlyBaseID:FBgn0039864 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_609767.2 Gene:Ku80 / 34930 FlyBaseID:FBgn0041627 Length:699 Species:Drosophila melanogaster


Alignment Length:279 Identity:52/279 - (18%)
Similarity:94/279 - (33%) Gaps:101/279 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EANLEDQ-YASFPEIRRPEVLKFLDWIHAQPHISDRFSE------GEALHFF---HACRYSMEVA 57
            :|.||.| .|:...:.|..:|...|: :..|...::|:|      ||.:...   |...|     
  Fly   104 QAALELQNVATTLRVARRRILLLFDF-NDFPQDYEKFNEITDELLGENIELIVGTHNIAY----- 162

  Fly    58 KQVLDTNLTARTHLEEFFVNLDCERPEIRRAMRTVSIVPLPGATPEGYRVILAKLDDLNTSNYNF 122
               :|..:|::.. ..|..:..|...|:......:|:||...||...::      :.|:|     
  Fly   163 ---IDNAITSQPQ-AIFNFSRKCGPDELNNQKYALSLVPRCNATLCSFK------EALHT----- 212

  Fly   123 ADVMKLYCMVFDF-----WMYEDGIQPGHVIVIDLKNTSLGHVARIGLLQMKKFLYYLQEAAAIR 182
                     ||..     |::...:..|..|.|.|:          |::.||       ....::
  Fly   213 ---------VFKVTNRRPWVWNAKLNIGSKISISLQ----------GIIAMK-------NQTPVK 251

  Fly   183 LIGF-------------HFI---NIVPFMDKIL--------------ALMTPFMKKELTTVLHMH 217
            |:..             |:|   .|.|..:.::              |::.|  |:.....||  
  Fly   252 LVKVWAEKDEIVIRETRHYIKGTEITPLPENLITGYMLGGTPVPYDEAVLEP--KEPHPPGLH-- 312

  Fly   218 SDLKEFYKFVPQEMLPKEY 236
                 |:.|:.:..:|.||
  Fly   313 -----FFGFIKRNAVPDEY 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11550NP_651882.1 CRAL_TRIO 94..239 CDD:279044 31/178 (17%)
Ku80NP_609767.2 Ku_N 7..213 CDD:281693 27/138 (20%)
KU80 221..524 CDD:238445 23/132 (17%)
Ku_PK_bind 562..663 CDD:285938
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.