DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11550 and CG31826

DIOPT Version :9

Sequence 1:NP_651882.1 Gene:CG11550 / 43731 FlyBaseID:FBgn0039864 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster


Alignment Length:279 Identity:56/279 - (20%)
Similarity:95/279 - (34%) Gaps:92/279 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LKFLDWIHAQPHISDRFSEGEALHFFHAC--RYSMEVAKQVLDTNLTARTHLEEFFVNLDCE--R 82
            |.:..|        |.....:|:|.::..  |:...||:..::       |..:.|....|.  .
  Fly    44 LHYTRW--------DTIKAYQAIHDYYEFKRRHPTWVARHPIE-------HYRQLFYGTHCRYVM 93

  Fly    83 PEIRRAMRTVSIVPLPGATPEG------YRVILAKLDDLNTSNYNFADVMKLYCMVFDFWMYEDG 141
            |:..|:.|.:.:.    .|.:|      |...|.::|||                :|:..:....
  Fly    94 PQADRSGRVLVVF----KTVDGFQDYPDYLQSLVEMDDL----------------IFESLLLLPR 138

  Fly   142 IQP-GHVIVIDLKNTSLGHVARIGLLQMKKFLYYLQEAAAIRLIGFHFINIV-------PFMDKI 198
            :|. |..::.||:.|:            :.||.....|         |:.:|       ||..:|
  Fly   139 VQQNGITVICDLQGTN------------RNFLRQFSPA---------FMKVVNEKNGVLPFSQRI 182

  Fly   199 L-------------ALMTPFMKKELTTVLHMHS--DLKEFYKFVPQEMLPKEYGGQLEEANVA-K 247
            :             .|..|||.||....:..|.  .|.:..:.|..|.||.||||  ...||. .
  Fly   183 VHIIQRGFLMHVTSTLFMPFMNKEFKEKIFTHDGRHLSKLREMVGYESLPAEYGG--PATNVLDT 245

  Fly   248 EIYYKKLLDNRKEMIEFET 266
            .:.:..|..|.:.:.:.:|
  Fly   246 NLIFNHLSQNAEYLEKLQT 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11550NP_651882.1 CRAL_TRIO 94..239 CDD:279044 36/173 (21%)
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024 5/24 (21%)
CRAL_TRIO 92..237 CDD:279044 38/185 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.