DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11550 and CG3091

DIOPT Version :9

Sequence 1:NP_651882.1 Gene:CG11550 / 43731 FlyBaseID:FBgn0039864 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_001284816.1 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster


Alignment Length:249 Identity:63/249 - (25%)
Similarity:122/249 - (48%) Gaps:18/249 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 WIHAQPHISDRFSEGEALHFFHACRYSMEVAKQVLDTNLTARTHLEEFFVNLDCERPEIRRAMRT 91
            |..|.|::.::......|.|.....:.:|..|.:.:.|...|......|::.:.|.......:|.
  Fly    32 WFEANPNLPEKIEPIVMLRFLKCTAFDVERTKALAELNYCMRNKSPHLFMDRNMEDEMTAEGLRV 96

  Fly    92 VSIVPLPGATPEGYRVILAKLDDLNTSNYNFADVMKLYCMV-----------------FDFWMYE 139
            ..::.|||.||:|.::|..::.||:....|..:..|::.|:                 .|:.:.|
  Fly    97 SDLLILPGVTPQGNKLIFFRMADLDPRTRNSVEETKIFVMMSDARFTKPDVERETGSGADYVLDE 161

  Fly   140 DGIQPGHVIVIDLKNTSLGHVARIGLLQMKKFLYYLQEAAAIRLIGFHFINIVPFMDKILALMTP 204
            ..|..|.|.::|:...:|.|:|.:.:..::.::.:||||...||...|.||...::||::::|:|
  Fly   162 ADIAEGDVQIVDIGGYTLRHLAYVSIFVLRVYMKFLQEAYPSRLQAMHVINCPTYLDKLISMMSP 226

  Fly   205 FMKKELTTVLHMHSD-LKEFYKFVPQEMLPKEYGGQLEEANVAKEIYYKKLLDN 257
            |:::|:..::..|:: :...||.||::|||.||||:.......|....:.:.||
  Fly   227 FLREEVRNMIRYHTEGMDSLYKEVPRDMLPNEYGGKAGTVAELKAKGIQSIRDN 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11550NP_651882.1 CRAL_TRIO 94..239 CDD:279044 47/162 (29%)
CG3091NP_001284816.1 SEC14 101..262 CDD:238099 47/160 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26017
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.