DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11550 and Sec14l5

DIOPT Version :9

Sequence 1:NP_651882.1 Gene:CG11550 / 43731 FlyBaseID:FBgn0039864 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_001129182.2 Gene:Sec14l5 / 287060 RGDID:1564638 Length:696 Species:Rattus norvegicus


Alignment Length:141 Identity:26/141 - (18%)
Similarity:61/141 - (43%) Gaps:24/141 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 VIDLKNTSLGHVARIGLLQMKKFLYYLQEAAAIRLIGFHFINIVPFMDKIL-ALMTPFMKKELTT 212
            ::||:..::.|:.|.|:..:.:.:..:::... ..:|...|...|.:..:| .|::||:.:....
  Rat   382 LLDLEGLNMRHLWRPGVKALLRMIEVVEDNYP-ETLGRLLIVRAPRVFPVLWTLVSPFINENTRR 445

  Fly   213 VLHMHSDLKEFYK-------FVPQEMLPKEYGGQL-----EEANVAKEIYYKKLLDNRKEMIE-- 263
            ...::|...  |:       ::.::::|...||:.     |...|.|.:|   |.:..:|..:  
  Rat   446 KFLIYSGSN--YQGPGGLVDYLDKDVIPDFLGGESVCNVPEGGMVPKSLY---LTEEEQEQADQL 505

  Fly   264 ---FETRHQVN 271
               .||.|..:
  Rat   506 RQWSETYHSAS 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11550NP_651882.1 CRAL_TRIO 94..239 CDD:279044 16/97 (16%)
Sec14l5NP_001129182.2 PRELI 17..173 CDD:309720
Amidase <179..309 CDD:327489
CRAL_TRIO_N 243..288 CDD:215024
CRAL_TRIO 314..477 CDD:306996 16/97 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.