DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11550 and SEC14L4

DIOPT Version :9

Sequence 1:NP_651882.1 Gene:CG11550 / 43731 FlyBaseID:FBgn0039864 Length:298 Species:Drosophila melanogaster
Sequence 2:XP_016884276.1 Gene:SEC14L4 / 284904 HGNCID:20627 Length:465 Species:Homo sapiens


Alignment Length:339 Identity:72/339 - (21%)
Similarity:123/339 - (36%) Gaps:87/339 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PEI-RRPEVLK---------FLDWIHAQPHISDRFSEGEALHFFHACRYSMEVAKQVLDTNLTAR 68
            ||: |.|..::         ..|.:...|:..|.|    .|.:..|..:.::.::.:|      |
Human    62 PEVMRAPPTIRSSSAQFRENLQDLLPILPNADDYF----LLRWLRARNFDLQKSEDML------R 116

  Fly    69 THLEEFFVNLDCER------PEIRRAMRTVSIVPLPGATPEG---YRVILAKLDD----LNTSNY 120
            .|: ||....|.:.      ||:   ::......|.|...||   |..|:..||.    |:.|. 
Human   117 RHM-EFRKQQDLDNIVTWQPPEV---IQLYDSGGLCGYDYEGCPVYFNIIGSLDPKGLLLSASK- 176

  Fly   121 NFADVMKLYCMVFDFWMYEDGIQPGH--------VIVIDLKNTSLGHVARIGLLQMKKFLYYLQE 177
              .|:::....|.:..::|..:|...        ::|.|::..||.|:.:..:...::|...|:.
Human   177 --QDMIRKRIKVCELLLHECELQTQKLGRKIEMALMVFDMEGLSLKHLWKPAVEVYQQFFSILEA 239

  Fly   178 AAAIRLIGFHFINIVPFMDKILALMTPFMKKELTTVLHMHSD--LKEFYKFVPQEMLPKEYGGQ- 239
            .....|.....|...........|:..||.:|....:.:..|  .:|..||:..:.||.|:||. 
Human   240 NYPETLKNLIVIRAPKLFPVAFNLVKSFMSEETRRKIVILGDNWKQELTKFISPDQLPVEFGGTM 304

  Fly   240 ---------LEEANVAKEI---YYKKLLDNRKEMIEFETRH----------QV-NEKLRPG---- 277
                     |.:.|...|:   ||      ..|.:..:..|          || ||.|.||    
Human   305 TDPDGNPKCLTKINYGGEVPKSYY------LCEQVRLQYEHTRSVGRGSSLQVENEILFPGCVLR 363

  Fly   278 --KAKNASDL-FGI 288
              .|.:..|: ||:
Human   364 WQFASDGGDIGFGV 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11550NP_651882.1 CRAL_TRIO 94..239 CDD:279044 35/161 (22%)
SEC14L4XP_016884276.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.