DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11550 and cgr-1

DIOPT Version :9

Sequence 1:NP_651882.1 Gene:CG11550 / 43731 FlyBaseID:FBgn0039864 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_508618.2 Gene:cgr-1 / 180650 WormBaseID:WBGene00020847 Length:383 Species:Caenorhabditis elegans


Alignment Length:154 Identity:28/154 - (18%)
Similarity:61/154 - (39%) Gaps:9/154 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 GHVIVIDLKNTSLGHVARIGLLQMKKFLYYLQEAAAIRLIGFHFINIVPFMDKILALMTPFMKKE 209
            |.:|::||...|:..:....|......|..||..........:.||....|..:.|:::|.:..:
 Worm   162 GVIIIMDLDGFSMDLLYTPTLKVYMSLLTMLQNIFPDFARRIYIINCPAMMSAVYAMVSPVLSSQ 226

  Fly   210 L-TTVLHMHSDLK-EFYKFVPQEMLPKEYGGQLEEANVAKEIYYKKLLDNRKEMIEFETRHQV-- 270
            . ..|..:..|.| ...:.:.:|.:...:||..:..:...:|   ::.....|.:.:...|::  
 Worm   227 TREKVRFLDKDWKNHLIEEIGEENIFMHWGGVKKHEHPCGDI---RMGGKVPESLWYADSHKLEG 288

  Fly   271 -NEKLR-PGKAKNASDLFGIEGNF 292
             ..|:. |.::|....::|..|.:
 Worm   289 DRTKIAVPARSKTEIKMYGESGKY 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11550NP_651882.1 CRAL_TRIO 94..239 CDD:279044 19/95 (20%)
cgr-1NP_508618.2 SEC14 91..257 CDD:214706 18/94 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.