DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11550 and ctg-2

DIOPT Version :9

Sequence 1:NP_651882.1 Gene:CG11550 / 43731 FlyBaseID:FBgn0039864 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_001254156.1 Gene:ctg-2 / 174360 WormBaseID:WBGene00011756 Length:408 Species:Caenorhabditis elegans


Alignment Length:229 Identity:45/229 - (19%)
Similarity:82/229 - (35%) Gaps:51/229 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 ALHFFHACRYSME-------VAKQVLDTNLTARTHLEEFFVNLDCERPEIRRAM----------- 89
            :|...||.....|       ||::..|.::..| :|....:.||.|...:...|           
 Worm    72 SLRAIHALGLDQEDLSTLEKVAQKCDDCSVPLR-YLPGSLIGLDHENNVVSLQMIGHLDAAGLMP 135

  Fly    90 --RTVSIVPLPGATPEGYRVILAKLDDLNTSNYNFADVMKLYCMVFDFWMYEDGIQPGHVIVIDL 152
              |...:..:..|..||...|:.|::.                        |.|...|..::.||
 Worm   136 ATRNSDLYRMRIAESEGVMQIIRKMEK------------------------EQGKPLGTSVIFDL 176

  Fly   153 KNTSLGHVARIGLLQMKKFLYYLQEAAAIRLIGFHFINIVPFMDKILALMTPFMKKEL-TTVLHM 216
            ...|:..:....|..:...|..|||.....:.....:|...|:..:.::::|.:.|:. ..|..:
 Worm   177 DGLSMVQIDLAALKVVTTMLSQLQEMFPDVIRKIFIVNTPTFIQVLWSMISPCLAKQTQQKVKIL 241

  Fly   217 HSDLKEFYK-FVPQEMLPKEYGG----QLEEANV 245
            .:|.|:..| .:.:|:|.:.:||    :.|..||
 Worm   242 GNDWKQHLKENIGEEVLFERWGGTRKAETEYGNV 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11550NP_651882.1 CRAL_TRIO 94..239 CDD:279044 28/150 (19%)
ctg-2NP_001254156.1 SEC14 98..267 CDD:214706 36/193 (19%)
EMP24_GP25L 331..>405 CDD:279450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.