DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek6 and LINGO1

DIOPT Version :9

Sequence 1:NP_001263151.1 Gene:kek6 / 43729 FlyBaseID:FBgn0039862 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_116197.4 Gene:LINGO1 / 84894 HGNCID:21205 Length:620 Species:Homo sapiens


Alignment Length:598 Identity:132/598 - (22%)
Similarity:201/598 - (33%) Gaps:224/598 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RSMDRRRSRTPRTLPVCW-ILLCLVAWTVADDWSLSCASNCTCKWTNGKKSAICSSLQLTTIPNT 66
            |||       |..|..|| .:|.||..:|....:..|...|.|...:  ::.:|...:...:|..
Human    13 RSM-------PSPLLACWQPILLLVLGSVLSGSATGCPPRCECSAQD--RAVLCHRKRFVAVPEG 68

  Fly    67 LSTELQVLVLNDNHIPYLNREEFSTL----------------------GLLNLQRIYLKKSEVQY 109
            :.||.::|.|..|.|..||::||::.                      .|.||:.:.|:.:.::.
Human    69 IPTETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAVEPGAFNNLFNLRTLGLRSNRLKL 133

  Fly   110 IHKESFRNLKILVEIDLSDNK-----------------LEMLDKD-------TFMGNDR------ 144
            |....|..|..|.::|:|:||                 ||:.|.|       .|.|.:.      
Human   134 IPLGVFTGLSNLTKLDISENKIVILLDYMFQDLYNLKSLEVGDNDLVYISHRAFSGLNSLEQLTL 198

  Fly   145 ---------------------LRILYLNGNPL-----KRLAAYQFPIL-----PHLRTLD----- 173
                                 ||:.:||.|.:     |||  |:..:|     |:|.|:.     
Human   199 EKCNLTSIPTEALSHLHGLIVLRLRHLNINAIRDYSFKRL--YRLKVLEISHWPYLDTMTPNCLY 261

  Fly   174 ---------------------------------------------MHDCL-----------ISYI 182
                                                         :|:.|           ::.:
Human   262 GLNLTSLSITHCNLTAVPYLAVRHLVYLRFLNLSYNPISTIEGSMLHELLRLQEIQLVGGQLAVV 326

  Fly   183 DPMSLANLNLLEFLNLKNNLLESLSEYVFQHMANLKTLSLEENPWQCNCKLRKF--RGWYVNSRL 245
            :|.:...||.|..||:..|.|.:|.|.||..:.||:||.|:.||..|:|:|...  |.|.:|  .
Human   327 EPYAFRGLNYLRVLNVSGNQLTTLEESVFHSVGNLETLILDSNPLACDCRLLWVFRRRWRLN--F 389

  Fly   246 SSVSLVCKGPPAQKDRTWDSVDDEL----FGCPPRVEIFNNEEVQ-NIDIGSNTTFSCLVYGDPL 305
            :.....|..|...:.:.:....|.|    |.| .|..|.:.:..| .:|.|....|.|...|||.
Human   390 NRQQPTCATPEFVQGKEFKDFPDVLLPNYFTC-RRARIRDRKAQQVFVDEGHTVQFVCRADGDPP 453

  Fly   306 PEVAWELNGKILDNDNVLFESESIASDKLWSNLTVFNVTSL--------DAGTYACTGSNSIG-- 360
            |.:.|            |...:.:.|.|....||||...:|        |.|||.|..:|:.|  
Human   454 PAILW------------LSPRKHLVSAKSNGRLTVFPDGTLEVRYAQVQDNGTYLCIAANAGGND 506

  Fly   361 SMTQNISIYLSEIVQHVLEKTPE-------TFWY--------------------FGLIMGIFGTV 398
            ||..::         ||...:|:       ||.:                    |.:...|..|.
Human   507 SMPAHL---------HVRSYSPDWPHQPNKTFAFISNQPGEGEANSTRATVPFPFDIKTLIIATT 562

  Fly   399 FLLISISFVVCLC 411
            ...||...||..|
Human   563 MGFISFLGVVLFC 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek6NP_001263151.1 leucine-rich repeat 71..96 CDD:275380 9/46 (20%)
LRR_8 96..155 CDD:290566 22/109 (20%)
leucine-rich repeat 97..120 CDD:275380 5/22 (23%)
leucine-rich repeat 121..144 CDD:275380 11/46 (24%)
LRR_4 144..186 CDD:289563 16/139 (12%)
leucine-rich repeat 145..168 CDD:275380 10/32 (31%)
leucine-rich repeat 169..216 CDD:275380 16/107 (15%)
LRRCT 225..274 CDD:214507 13/54 (24%)
Ig 295..367 CDD:143165 24/81 (30%)
LINGO1NP_116197.4 LRRNT 41..75 CDD:214470 7/35 (20%)
LRR <66..371 CDD:227223 62/306 (20%)
LRR 1 72..93 9/20 (45%)
leucine-rich repeat 73..96 CDD:275380 8/22 (36%)
LRR 2 96..117 0/20 (0%)
leucine-rich repeat 97..120 CDD:275380 1/22 (5%)
LRR_8 120..179 CDD:338972 14/58 (24%)
LRR 3 120..141 5/20 (25%)
leucine-rich repeat 121..144 CDD:275380 5/22 (23%)
LRR 4 144..165 5/20 (25%)
leucine-rich repeat 145..192 CDD:275380 11/46 (24%)
LRR 5 168..189 5/20 (25%)
LRR 6 192..213 0/20 (0%)
leucine-rich repeat 193..216 CDD:275380 0/22 (0%)
LRR 7 216..237 5/20 (25%)
leucine-rich repeat 217..264 CDD:275380 13/48 (27%)
LRR 8 264..285 0/20 (0%)
leucine-rich repeat 265..288 CDD:275380 0/22 (0%)
LRR 9 288..309 0/20 (0%)
leucine-rich repeat 289..312 CDD:275380 1/22 (5%)
LRR 10 312..333 1/20 (5%)
leucine-rich repeat 313..336 CDD:275380 2/22 (9%)
LRR 11 336..357 9/20 (45%)
leucine-rich repeat 337..357 CDD:275380 9/19 (47%)
PCC 341..>421 CDD:188093 25/81 (31%)
Ig 439..514 CDD:386229 25/95 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41933
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.