| Sequence 1: | NP_001263151.1 | Gene: | kek6 / 43729 | FlyBaseID: | FBgn0039862 | Length: | 843 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_115605.2 | Gene: | SLITRK6 / 84189 | HGNCID: | 23503 | Length: | 841 | Species: | Homo sapiens |
| Alignment Length: | 252 | Identity: | 71/252 - (28%) |
|---|---|---|---|
| Similarity: | 117/252 - (46%) | Gaps: | 27/252 - (10%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 37 SCASNCTCKWTNGKKSAICSS-----LQLTTIPNTLSTELQVLVLNDNHIPYLNREEFSTLGLLN 96
Fly 97 LQRIYLKKSEVQYIHKESFRNLKILVEIDLSDNKLEMLDKDTFMGNDRLRILYLNGNPLKRLAAY 161
Fly 162 QFPILPHLRTLDMHDCLISYIDPMSLANLNLLEF-----LNLKNNLLESLSEYV--FQHMANLKT 219
Fly 220 LSLEENPWQCNCKLRKFRGWYVNSRLSSV--SLVCKGPPAQKDRTWDSVDDELFGCP 274 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kek6 | NP_001263151.1 | leucine-rich repeat | 71..96 | CDD:275380 | 8/24 (33%) |
| LRR_8 | 96..155 | CDD:290566 | 18/58 (31%) | ||
| leucine-rich repeat | 97..120 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 121..144 | CDD:275380 | 9/22 (41%) | ||
| LRR_4 | 144..186 | CDD:289563 | 10/41 (24%) | ||
| leucine-rich repeat | 145..168 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 169..216 | CDD:275380 | 15/53 (28%) | ||
| LRRCT | 225..274 | CDD:214507 | 15/50 (30%) | ||
| Ig | 295..367 | CDD:143165 | |||
| SLITRK6 | NP_115605.2 | PLN00113 | 69..>494 | CDD:331614 | 63/213 (30%) |
| leucine-rich repeat | 69..89 | CDD:275380 | 8/24 (33%) | ||
| LRR 1 | 89..110 | 5/20 (25%) | |||
| LRR_8 | 92..146 | CDD:316378 | 16/53 (30%) | ||
| leucine-rich repeat | 94..113 | CDD:275380 | 4/18 (22%) | ||
| LRR 2 | 113..134 | 8/20 (40%) | |||
| leucine-rich repeat | 114..137 | CDD:275380 | 9/22 (41%) | ||
| LRR_8 | 137..195 | CDD:316378 | 15/63 (24%) | ||
| LRR 3 | 137..158 | 4/20 (20%) | |||
| leucine-rich repeat | 138..161 | CDD:275380 | 5/22 (23%) | ||
| LRR 4 | 161..182 | 6/26 (23%) | |||
| leucine-rich repeat | 162..177 | CDD:275380 | 4/14 (29%) | ||
| LRR 5 | 184..205 | 7/21 (33%) | |||
| leucine-rich repeat | 185..260 | CDD:275380 | 25/75 (33%) | ||
| leucine-rich repeat | 261..412 | CDD:275380 | 3/9 (33%) | ||
| LRR 6 | 364..385 | ||||
| leucine-rich repeat | 366..388 | CDD:275380 | |||
| LRR 7 | 388..409 | ||||
| LRR_8 | 411..471 | CDD:316378 | |||
| LRR 8 | 412..433 | ||||
| leucine-rich repeat | 413..436 | CDD:275380 | |||
| LRR 9 | 436..457 | ||||
| leucine-rich repeat | 437..460 | CDD:275380 | |||
| LRR_8 | 459..518 | CDD:316378 | |||
| LRR 10 | 460..481 | ||||
| leucine-rich repeat | 461..482 | CDD:275380 | |||
| LRR 11 | 483..504 | ||||
| LRRCT | 517..567 | CDD:214507 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||