DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek6 and LRFN3

DIOPT Version :9

Sequence 1:NP_001263151.1 Gene:kek6 / 43729 FlyBaseID:FBgn0039862 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_078785.1 Gene:LRFN3 / 79414 HGNCID:28370 Length:628 Species:Homo sapiens


Alignment Length:393 Identity:96/393 - (24%)
Similarity:159/393 - (40%) Gaps:62/393 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ILLCLVAWTVADDWSLS-----CASNCTCKWTNGKKSAICSSLQLTTIPNTLSTELQVLVLNDNH 80
            :||||:....|.....|     |...|.|:..:...|.:|....|..:|.:|......|.|.||.
Human     6 LLLCLLPLAPASSPPQSATPSPCPRRCRCQTQSLPLSVLCPGAGLLFVPPSLDRRAAELRLADNF 70

  Fly    81 IPYLNREEFSTL-GLLNLQRIYLKKSEVQYIHKESFRNLKILVEIDLSDNKLEMLDKDTFMGNDR 144
            |..:.|.:.:.: |||:|.   |.::.::::...:|.:|:.|..:.|..|:|..|.:....|...
Human    71 IASVRRRDLANMTGLLHLS---LSRNTIRHVAAGAFADLRALRALHLDGNRLTSLGEGQLRGLVN 132

  Fly   145 LRILYLNGNPLKRLAA--------------------YQFP-----ILPHLRTLDMHDCLISYIDP 184
            ||.|.|:.|.|..|||                    .|.|     .|.::.||.:...|::.:..
Human   133 LRHLILSNNQLAALAAGALDDCAETLEDLDLSYNNLEQLPWEALGRLGNVNTLGLDHNLLASVPA 197

  Fly   185 MSLANLNLLEFLNLKNNLLESL-SEYVFQHM----------ANLKTLSLEENPWQCNCKLRKFRG 238
            .:.:.|:.|..|::.:|.|.:: .:.:|..:          |:...|:...||..|||:|...|.
Human   198 GAFSRLHKLARLDMTSNRLTTIPPDPLFSRLPLLARPRGSPASALVLAFGGNPLHCNCELVWLRR 262

  Fly   239 WYVNSRLSSVSLVCKGPPAQKDRTWDSVDDELFGCPPRVEIFNNEEVQNIDIGSNTTFSCLVYGD 303
            ......|.:    |..|||...|.:.:|.:|.|.|.|.| :.:......:..|......|...||
Human   263 LAREDDLEA----CASPPALGGRYFWAVGEEEFVCEPPV-VTHRSPPLAVPAGRPAALRCRAVGD 322

  Fly   304 PLPEVAW-ELNGKILDNDNVLFESESIASDKLWSNLTV-FNVTSL-DAGTYACTGSNSIGSMTQN 365
            |.|.|.| ...|::|.|.         :..:.:.|.|: ..||.. |.|.:.|..:|:.|..|..
Human   323 PEPRVRWVSPQGRLLGNS---------SRARAFPNGTLELLVTEPGDGGIFTCIAANAAGEATAA 378

  Fly   366 ISI 368
            :.:
Human   379 VEL 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek6NP_001263151.1 leucine-rich repeat 71..96 CDD:275380 8/25 (32%)
LRR_8 96..155 CDD:290566 15/58 (26%)
leucine-rich repeat 97..120 CDD:275380 4/22 (18%)
leucine-rich repeat 121..144 CDD:275380 6/22 (27%)
LRR_4 144..186 CDD:289563 15/66 (23%)
leucine-rich repeat 145..168 CDD:275380 12/47 (26%)
leucine-rich repeat 169..216 CDD:275380 9/57 (16%)
LRRCT 225..274 CDD:214507 16/48 (33%)
Ig 295..367 CDD:143165 20/74 (27%)
LRFN3NP_078785.1 LRR_8 59..119 CDD:290566 16/62 (26%)
LRR 1 60..83 6/22 (27%)
LRR_RI <63..168 CDD:238064 28/107 (26%)
leucine-rich repeat 63..84 CDD:275380 6/20 (30%)
LRR 2 84..105 6/23 (26%)
leucine-rich repeat 85..108 CDD:275380 6/25 (24%)
LRR 3 108..129 5/20 (25%)
leucine-rich repeat 109..132 CDD:275380 6/22 (27%)
LRR 4 132..153 9/20 (45%)
leucine-rich repeat 133..157 CDD:275380 9/23 (39%)
LRR_8 157..216 CDD:290566 10/58 (17%)
LRR 5 157..178 2/20 (10%)
leucine-rich repeat 158..181 CDD:275380 3/22 (14%)
LRR 6 181..202 3/20 (15%)
leucine-rich repeat 182..205 CDD:275380 4/22 (18%)
LRR 7 205..226 4/20 (20%)
leucine-rich repeat 206..230 CDD:275380 5/23 (22%)
leucine-rich repeat 242..253 CDD:275378 3/10 (30%)
TPKR_C2 249..>281 CDD:301599 12/35 (34%)
IG_like 302..383 CDD:214653 21/89 (24%)
Ig 310..383 CDD:299845 21/81 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 382..430 96/393 (24%)
fn3 424..502 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 127 1.000 Inparanoid score I4688
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.