DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek6 and LRFN4

DIOPT Version :9

Sequence 1:NP_001263151.1 Gene:kek6 / 43729 FlyBaseID:FBgn0039862 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_001350453.1 Gene:LRFN4 / 78999 HGNCID:28456 Length:635 Species:Homo sapiens


Alignment Length:385 Identity:102/385 - (26%)
Similarity:162/385 - (42%) Gaps:60/385 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ILLCLVAWTVADDWSLSCASNCTCKWTNGKKSAICSSLQLTTIPNTLSTELQVLVLNDNHIPYLN 85
            :||.|:|...|     :|...|.|:..:...|.:|:...|..:|..:......|.|.||.|..|.
Human     5 LLLLLLASGAA-----ACPLPCVCQNLSESLSTLCAHRGLLFVPPNVDRRTVELRLADNFIQALG 64

  Fly    86 REEFSTL-GLLNLQRIYLKKSEVQYIHKESFRNLKILVEIDLSDNKLEMLDKDTFMGNDRLRILY 149
            ..:|..: ||::|.   |.::.:..|...:|.:|:.|..:.|..|:|..|...:..|...|:.|.
Human    65 PPDFRNMTGLVDLT---LSRNAITRIGARAFGDLESLRSLHLDGNRLVELGTGSLRGPVNLQHLI 126

  Fly   150 LNGNPLKRLA----------------AY----QFP-----ILPHLRTLDMHDCLISYIDPMSLAN 189
            |:||.|.|:|                :|    |.|     .:|.|.||::...||..:.|.:.|.
Human   127 LSGNQLGRIAPGAFDDFLESLEDLDLSYNNLRQVPWAGIGAMPALHTLNLDHNLIDALPPGAFAQ 191

  Fly   190 LNLLEFLNLKNNLLESLS-EYVFQHMANLK------TLSLEENPWQCNCKLRKFRGWYVNSRLSS 247
            |..|..|:|.:|.|.:|: :.:|....:.:      .||...||..|||:|...|      ||:.
Human   192 LGQLSRLDLTSNRLATLAPDPLFSRGRDAEASPAPLVLSFSGNPLHCNCELLWLR------RLAR 250

  Fly   248 VS--LVCKGPPAQKDRTWDSVDDELFGCPPRVEIFNNEEVQNIDIGSNTTFSCLVYGDPLPEVAW 310
            ..  ..|..||....|.:.:|.:..|.|.|.:...:.:.:..:: |...|..|...|||.|.:.|
Human   251 PDDLETCASPPGLAGRYFWAVPEGEFSCEPPLIARHTQRLWVLE-GQRATLRCRALGDPAPTMHW 314

  Fly   311 ELNGKILDNDNVLFESESIASDKLWSNLTV-FNVTSL-DAGTYACTGSNSIGSMTQNISI 368
                  :..|:.|..:.|.|  :.:.|.|: ..||.. |||.|.|..:|..|..|..:.:
Human   315 ------VGPDDRLVGNSSRA--RAFPNGTLEIGVTGAGDAGGYTCIATNPAGEATARVEL 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek6NP_001263151.1 leucine-rich repeat 71..96 CDD:275380 9/25 (36%)
LRR_8 96..155 CDD:290566 16/58 (28%)
leucine-rich repeat 97..120 CDD:275380 5/22 (23%)
leucine-rich repeat 121..144 CDD:275380 6/22 (27%)
LRR_4 144..186 CDD:289563 18/66 (27%)
leucine-rich repeat 145..168 CDD:275380 11/47 (23%)
leucine-rich repeat 169..216 CDD:275380 15/47 (32%)
LRRCT 225..274 CDD:214507 15/50 (30%)
Ig 295..367 CDD:143165 23/73 (32%)
LRFN4NP_001350453.1 LRR_8 48..108 CDD:316378 17/62 (27%)
LRR 1 49..70 7/20 (35%)
leucine-rich repeat 50..73 CDD:275380 7/22 (32%)
LRR 2 73..94 6/23 (26%)
leucine-rich repeat 74..97 CDD:275380 6/25 (24%)
LRR_8 97..157 CDD:316378 15/59 (25%)
LRR 3 97..118 5/20 (25%)
leucine-rich repeat 98..121 CDD:275380 6/22 (27%)
LRR 4 121..142 8/20 (40%)
leucine-rich repeat 122..146 CDD:275380 8/23 (35%)
LRR_8 146..205 CDD:316378 16/58 (28%)
LRR 5 146..161 2/14 (14%)
leucine-rich repeat 147..170 CDD:275380 3/22 (14%)
LRR 6 170..191 6/20 (30%)
leucine-rich repeat 171..194 CDD:275380 8/22 (36%)
LRR 7 194..215 6/20 (30%)
leucine-rich repeat 195..213 CDD:275380 6/17 (35%)
LRRCT 234..278 CDD:214507 15/49 (31%)
Ig_2 295..368 CDD:143241 24/80 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 373..410
fn3 409..478 CDD:306538
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 555..583
PDZ-binding 632..635
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 127 1.000 Inparanoid score I4688
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.