DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek6 and RTN4R

DIOPT Version :9

Sequence 1:NP_001263151.1 Gene:kek6 / 43729 FlyBaseID:FBgn0039862 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_075380.1 Gene:RTN4R / 65078 HGNCID:18601 Length:473 Species:Homo sapiens


Alignment Length:307 Identity:79/307 - (25%)
Similarity:119/307 - (38%) Gaps:60/307 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VCWILLCLVAWTVADDWSLSCASNCTCKWTNGKKSAICSSLQLTTIPNTLSTELQVLVLNDNHIP 82
            :.|: |.|.||.||    ..|...|.| :...|.:..|....|..:|..:....|.:.|:.|.|.
Human    12 LAWV-LWLQAWQVA----APCPGACVC-YNEPKVTTSCPQQGLQAVPVGIPAASQRIFLHGNRIS 70

  Fly    83 YLNREEFSTLGLLNLQRIYLKKSEVQYIHKESFRNLKILVEIDLSDN-KLEMLDKDTFMGNDR-- 144
            ::....|.  ...||..::|..:.:..|...:|..|.:|.::||||| :|..:|..||.|..|  
Human    71 HVPAASFR--ACRNLTILWLHSNVLARIDAAAFTGLALLEQLDLSDNAQLRSVDPATFHGLGRLH 133

  Fly   145 ----------------------LRILYLNGNPLKRLAAYQFPILPHLRTLDMHDCLISYIDPMSL 187
                                  |:.|||..|.|:.|....|..|.:|..|.:|...||.:...:.
Human   134 TLHLDRCGLQELGPGLFRGLAALQYLYLQDNALQALPDDTFRDLGNLTHLFLHGNRISSVPERAF 198

  Fly   188 ANLNLLEFLNLKNNLLESLSEYVFQHMANLKT------------------------LSLEENPWQ 228
            ..|:.|:.|.|..|.:..:..:.|:.:..|.|                        |.|.:|||.
Human   199 RGLHSLDRLLLHQNRVAHVHPHAFRDLGRLMTLYLFANNLSALPTEALAPLRALQYLRLNDNPWV 263

  Fly   229 CNCKLRKFRGWYVNSRLSSVSLVCKGPP--AQKDRTWDSVDDELFGC 273
            |:|:.|....|....|.||..:.|..|.  |.:|....:.:| |.||
Human   264 CDCRARPLWAWLQKFRGSSSEVPCSLPQRLAGRDLKRLAAND-LQGC 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek6NP_001263151.1 leucine-rich repeat 71..96 CDD:275380 5/24 (21%)
LRR_8 96..155 CDD:290566 23/83 (28%)
leucine-rich repeat 97..120 CDD:275380 5/22 (23%)
leucine-rich repeat 121..144 CDD:275380 11/23 (48%)
LRR_4 144..186 CDD:289563 15/65 (23%)
leucine-rich repeat 145..168 CDD:275380 9/22 (41%)
leucine-rich repeat 169..216 CDD:275380 11/46 (24%)
LRRCT 225..274 CDD:214507 18/51 (35%)
Ig 295..367 CDD:143165
RTN4RNP_075380.1 LRR 1. /evidence=ECO:0000255 55..79 5/25 (20%)
leucine-rich repeat 60..82 CDD:275380 5/23 (22%)
LRR 2. /evidence=ECO:0000255 81..103 5/21 (24%)
LRR_8 82..142 CDD:338972 18/59 (31%)
leucine-rich repeat 83..106 CDD:275380 5/22 (23%)
LRR 3. /evidence=ECO:0000255 104..128 11/23 (48%)
leucine-rich repeat 107..131 CDD:275380 11/23 (48%)
LRR 4. /evidence=ECO:0000255 129..152 1/22 (5%)
leucine-rich repeat 132..155 CDD:275380 0/22 (0%)
LRR 5. /evidence=ECO:0000255 153..176 8/22 (36%)
LRR_8 156..214 CDD:338972 19/57 (33%)
leucine-rich repeat 156..179 CDD:275380 9/22 (41%)
LRR 6. /evidence=ECO:0000255 178..200 5/21 (24%)
leucine-rich repeat 180..203 CDD:275380 6/22 (27%)
LRR 7. /evidence=ECO:0000255 202..224 5/21 (24%)
LRR_8 203..261 CDD:338972 9/57 (16%)
leucine-rich repeat 204..227 CDD:275380 5/22 (23%)
LRR 8. /evidence=ECO:0000255 225..248 2/22 (9%)
leucine-rich repeat 228..251 CDD:275380 2/22 (9%)
LRR 9. /evidence=ECO:0000255 250..273 8/22 (36%)
TPKR_C2 260..>296 CDD:387596 13/35 (37%)
DUF390 332..>417 CDD:282014
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 346..447
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.