DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek6 and lrfn2b

DIOPT Version :9

Sequence 1:NP_001263151.1 Gene:kek6 / 43729 FlyBaseID:FBgn0039862 Length:843 Species:Drosophila melanogaster
Sequence 2:XP_009292765.1 Gene:lrfn2b / 558484 ZFINID:ZDB-GENE-121214-111 Length:781 Species:Danio rerio


Alignment Length:383 Identity:91/383 - (23%)
Similarity:160/383 - (41%) Gaps:54/383 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SCASNCTCKWTNGKKSAICSSLQLTTIPNTLSTELQVLVLNDNHIPYLNREEFSTLGLLNLQRIY 101
            :|...|.|:..:.....:|.:..|..:|:.:......|.|..|.|..:.:::|:  .:.:|..:.
Zfish    20 ACPKYCACQNLSESLGTLCPAKGLLFVPSDIDRSTVELRLGGNFILRITQQDFA--NMTDLVDLT 82

  Fly   102 LKKSEVQYIHKESFRNLKILVEIDLSDNKLEMLDKDTFMGNDRLRILYLNGNPLKRLAAYQF--- 163
            |.::.:.||...||.:|:.|..:.:.:|:|..|..|...|...|:.|.||.|.|.|::...|   
Zfish    83 LSRNTISYIQPFSFGDLETLRSLHMDNNRLTELGPDDLRGLISLQHLILNNNQLSRVSERAFEDL 147

  Fly   164 --------------PILP--------HLRTLDMHDCLISYIDPMSLANLNLLEFLNLKNNLLESL 206
                          ..||        :|..|.:...|:.||...:..:|..|..|:|.:|.|:.|
Zfish   148 AATLEDLDLSYNNLQALPWHSVRQMINLHQLSLDHNLLDYIPEGTFVDLERLARLDLTSNRLQKL 212

  Fly   207 -----------SEYVFQHMANLKTLSLEENPWQCNCKLRKFRGWYVNSRLSSVSLVCKGPPAQKD 260
                       ||.:....|...:||:..||..|||:|..||....:..|.:    |..||..|.
Zfish   213 PPDPIFARAQDSEVMTTPFAPQLSLSIGGNPLHCNCELLWFRRLERDDDLET----CASPPGLKG 273

  Fly   261 RTWDSVDDELFGCPPRVEIFNNEEVQNIDIGSNTTFSCLVYGDPLPEVAWELNGKILDNDNVLFE 325
            |.:.:|.:..|.|...:...:..::..:: |...:..|...|||:|.:.|     :...|.:|..
Zfish   274 RYFWNVREHEFLCEQPLITQHTHKLLALE-GQTASLRCDAIGDPIPTIHW-----VTPEDRLLGN 332

  Fly   326 SESIASDKLWSN--LTVFNVTSLDAGTYACTGSNSIGSMTQNISIYLSEIVQHVLEKT 381
            |....   ::.|  |.:...||.|:||:.|..:|..|..|.::.:.:.:: .|:...|
Zfish   333 SSRTV---VYRNGTLEILITTSKDSGTFTCIAANLAGESTASVELSIIQL-PHISNGT 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek6NP_001263151.1 leucine-rich repeat 71..96 CDD:275380 5/24 (21%)
LRR_8 96..155 CDD:290566 18/58 (31%)
leucine-rich repeat 97..120 CDD:275380 7/22 (32%)
leucine-rich repeat 121..144 CDD:275380 6/22 (27%)
LRR_4 144..186 CDD:289563 15/66 (23%)
leucine-rich repeat 145..168 CDD:275380 10/47 (21%)
leucine-rich repeat 169..216 CDD:275380 14/57 (25%)
LRRCT 225..274 CDD:214507 16/48 (33%)
Ig 295..367 CDD:143165 20/73 (27%)
lrfn2bXP_009292765.1 LRR_RI 27..>209 CDD:238064 42/183 (23%)
LRR_8 52..112 CDD:290566 14/61 (23%)
leucine-rich repeat 54..77 CDD:275380 5/24 (21%)
leucine-rich repeat 78..101 CDD:275380 7/22 (32%)
LRR_8 101..161 CDD:290566 14/59 (24%)
LRR_4 102..141 CDD:289563 13/38 (34%)
leucine-rich repeat 102..125 CDD:275380 6/22 (27%)
leucine-rich repeat 126..149 CDD:275380 8/22 (36%)
LRR_8 150..209 CDD:290566 12/58 (21%)
leucine-rich repeat 151..174 CDD:275380 2/22 (9%)
leucine-rich repeat 175..198 CDD:275380 6/22 (27%)
leucine-rich repeat 235..246 CDD:275378 4/10 (40%)
LRRCT 242..>274 CDD:214507 13/35 (37%)
I-set 289..376 CDD:254352 21/95 (22%)
Ig 303..376 CDD:299845 21/80 (26%)
fn3 418..485 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6336
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.