DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek6 and lrit2

DIOPT Version :9

Sequence 1:NP_001263151.1 Gene:kek6 / 43729 FlyBaseID:FBgn0039862 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_001018372.2 Gene:lrit2 / 553557 ZFINID:ZDB-GENE-050522-160 Length:561 Species:Danio rerio


Alignment Length:392 Identity:94/392 - (23%)
Similarity:157/392 - (40%) Gaps:71/392 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LPVCWILLCLVAWTVADDWSLSCASNCTCKWTNGKKSAICSSLQLTTIPNTLSTELQVLVLNDNH 80
            :.||.:...:|...:....|..|...|:|......:|..|....||.||:.|..:          
Zfish     1 MDVCVLFHLIVFCILISHISSECFPGCSCGTDRHGRSLTCMETALTGIPDGLPED---------- 55

  Fly    81 IPYLNREEFSTLGLLNLQRIYLKKSEVQYIHKESFRNLKILVEIDLSDNKLEMLDKDTFMGNDRL 145
                            |.:|.::||::..:.:..|.::|.|..:.|:.|.:.:::..:..|...|
Zfish    56 ----------------LTKIRIEKSQLSELPEAVFSHVKALKHLWLNFNDIAIINIKSLEGLANL 104

  Fly   146 RILYLNGNPLKRLAAYQFPILPHLRTLDMHDCLISYIDPMSLANLNLLEFLNLKNNLLESLSEYV 210
            ..|.|.||.|:.:....|...|:|:.||:....|..:...:|..|..|.:|:|.:|.|..:|:.|
Zfish   105 TELRLQGNKLRSVPWTAFEETPNLKILDLKHNRIDALPEHALKFLPGLTYLDLSSNQLSVISKDV 169

  Fly   211 F----------QH---MANLKTLSLEENPWQCNCKLRKFRGWYVNSR-----LSSVSLVCKGPPA 257
            |          :|   .|:...|:|.:|||.|:|:|..|.. ::.|.     |.:..|.|..|..
Zfish   170 FLNWPLYHSENKHEKPSASNVVLALHDNPWLCDCRLGGFIE-FIKSLTPPFILMNSYLTCSSPEL 233

  Fly   258 QKDRTWDSVDDELFGC------PPRVEIFNNEEVQNIDIGSNTTFSCLVYGDPLPEVAWELNGKI 316
            :..|.:..||  |..|      .|.:.|       ...:|.|.|.:|.....|...:.|....|:
Zfish   234 KAGRFFHEVD--LKTCVKPVVSAPVITI-------TAPLGGNVTLTCSASARPEAVIRWIYALKM 289

  Fly   317 LDNDNVLFESESIASDKLWSNLTVFNVTSLDAGTYACTGSNSIGSMTQNISIYLSEIVQHVLEKT 381
            |.....:.  ..:..|.:.|.|.:.::.|.|.|.|.|..:|.:|    |.|:.:|..|     |:
Zfish   290 LRGFRDIL--SHVDEDTISSQLVIPSLHSADRGLYTCIANNFLG----NSSVIISVDV-----KS 343

  Fly   382 PE 383
            ||
Zfish   344 PE 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek6NP_001263151.1 leucine-rich repeat 71..96 CDD:275380 0/24 (0%)
LRR_8 96..155 CDD:290566 15/58 (26%)
leucine-rich repeat 97..120 CDD:275380 5/22 (23%)
leucine-rich repeat 121..144 CDD:275380 4/22 (18%)
LRR_4 144..186 CDD:289563 12/41 (29%)
leucine-rich repeat 145..168 CDD:275380 7/22 (32%)
leucine-rich repeat 169..216 CDD:275380 15/59 (25%)
LRRCT 225..274 CDD:214507 17/59 (29%)
Ig 295..367 CDD:143165 17/71 (24%)
lrit2NP_001018372.2 LRR 1 55..76 5/46 (11%)
LRR_8 56..114 CDD:290566 15/57 (26%)
leucine-rich repeat 56..79 CDD:275378 5/22 (23%)
LRR_4 78..118 CDD:289563 11/39 (28%)
LRR 2 79..102 4/22 (18%)
leucine-rich repeat 80..103 CDD:275378 4/22 (18%)
LRR_8 103..162 CDD:290566 18/58 (31%)
LRR_4 103..143 CDD:289563 12/39 (31%)
LRR 3 103..124 7/20 (35%)
leucine-rich repeat 104..127 CDD:275378 7/22 (32%)
LRR_4 126..166 CDD:289563 12/39 (31%)
LRR 4 127..150 5/22 (23%)
leucine-rich repeat 128..151 CDD:275378 6/22 (27%)
LRR 5 151..172 8/20 (40%)
leucine-rich repeat 152..165 CDD:275378 5/12 (42%)
leucine-rich repeat 189..201 CDD:275378 5/11 (45%)
TPKR_C2 197..240 CDD:301599 13/43 (30%)
IG_like 258..341 CDD:214653 22/95 (23%)
IGc2 264..328 CDD:197706 16/65 (25%)
fn3 366..438 CDD:278470
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 507..561
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.