DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek6 and Lrit3

DIOPT Version :9

Sequence 1:NP_001263151.1 Gene:kek6 / 43729 FlyBaseID:FBgn0039862 Length:843 Species:Drosophila melanogaster
Sequence 2:XP_006232069.1 Gene:Lrit3 / 502596 RGDID:1559637 Length:702 Species:Rattus norvegicus


Alignment Length:402 Identity:97/402 - (24%)
Similarity:168/402 - (41%) Gaps:83/402 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 WILLCL-VAWTVADDWSLSCASNCTCKW-----TNGKKSAICSSLQLTTIPNTLSTELQVLVLND 78
            |:..|| :..:.....:.:|.|.|:|::     .:|.:|.:|:.|.:..:|..|..:...|.:..
  Rat     2 WLFACLCLVLSFLGGVNCTCPSQCSCEYHGRHEGSGSRSVLCNDLDMNEVPTNLPVDTAKLRIEK 66

  Fly    79 NHIPYLNREEFSTLGLLNLQRIYLKKSEVQYIHKESFRNLKILVEIDLSDNKLEMLDKDTFMGND 143
            ..:..:..|.|  ..|:.||.::|..:.|..|...||.|||.|.|:.|..|.|.           
  Rat    67 TVVRRIPAEAF--YYLVELQYLWLTYNSVASIETRSFYNLKQLHELRLDGNSLT----------- 118

  Fly   144 RLRILYLNGNPLKRLAAYQFP-----ILPHLRTLDMHDCLISYIDPMSLANLNLLEFLNLKNNLL 203
                              :||     .:|||||||:|:..|:.:...::..|..|..|:|.:|.|
  Rat   119 ------------------EFPWASLLDMPHLRTLDLHNNRITSVTNEAVRYLRNLTCLDLSSNRL 165

  Fly   204 ESL-SEYV--FQHMANLKT-----------LSLEENPWQCNCKLRKFRGWYVNSRLSSVS----- 249
            .:| .:::  :.|:|...:           |.|::|||.|:|.:.|.      ..||.|:     
  Rat   166 TTLPPDFLDSWSHLAMTPSRSPDLPPKRIILGLQDNPWFCDCHISKV------IELSKVADHAAV 224

  Fly   250 -----LVCKGPPAQKDRTWDSVDDELFGCPPRVEIFNNEEVQNIDIGSNTTFSCLVYGDPLPEVA 309
                 :||..|...:...:..|  ||..|.....:.:..::.:. :|||....|...|.|.|::.
  Rat   225 LLDPLMVCSEPEYLQGIAFQRV--ELEKCLKPSVMMSATKITSA-LGSNVLLRCDAKGYPTPQLM 286

  Fly   310 WELNGKILDNDNVLFES--ESIASDKLWSNLTVFNVTSLDAGTYACTGSNSIGSMTQNISIYLSE 372
            |..:.....|..|:.||  |.:.    ||.|::..:|..|||.|:|...|..|:....:::.:..
  Rat   287 WTRSDSSPVNATVIQESPGEGVR----WSILSLTGITYRDAGDYSCKAKNLAGTSEAVVTVTVVG 347

  Fly   373 IVQHVLEKTPET 384
            :....|  :|:|
  Rat   348 VATTTL--SPDT 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek6NP_001263151.1 leucine-rich repeat 71..96 CDD:275380 4/24 (17%)
LRR_8 96..155 CDD:290566 15/58 (26%)
leucine-rich repeat 97..120 CDD:275380 9/22 (41%)
leucine-rich repeat 121..144 CDD:275380 5/22 (23%)
LRR_4 144..186 CDD:289563 11/46 (24%)
leucine-rich repeat 145..168 CDD:275380 2/27 (7%)
leucine-rich repeat 169..216 CDD:275380 15/49 (31%)
LRRCT 225..274 CDD:214507 15/58 (26%)
Ig 295..367 CDD:143165 21/73 (29%)
Lrit3XP_006232069.1 LRR_8 61..117 CDD:290566 18/57 (32%)
LRR_4 83..121 CDD:289563 15/66 (23%)
leucine-rich repeat 83..106 CDD:275378 9/22 (41%)
LRR_8 105..165 CDD:290566 22/88 (25%)
LRR_4 105..146 CDD:289563 17/69 (25%)
leucine-rich repeat 107..130 CDD:275378 7/51 (14%)
LRR_4 129..170 CDD:289563 16/40 (40%)
leucine-rich repeat 131..154 CDD:275378 8/22 (36%)
leucine-rich repeat 155..168 CDD:275378 5/12 (42%)
IGc2 268..335 CDD:197706 23/70 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6815
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.