DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek6 and CG5810

DIOPT Version :9

Sequence 1:NP_001263151.1 Gene:kek6 / 43729 FlyBaseID:FBgn0039862 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_650952.2 Gene:CG5810 / 42513 FlyBaseID:FBgn0038866 Length:428 Species:Drosophila melanogaster


Alignment Length:214 Identity:50/214 - (23%)
Similarity:95/214 - (44%) Gaps:37/214 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 WILLCLVAWTVADDW--------SLSCASNCTCKWTNGKKSAICSSLQLTTIPNTLSTELQVLVL 76
            :||:.::|:...:..        ||.|..| ||  ||.|..:..:                |...
  Fly     9 YILIAVIAFATCESQKLEEIAIDSLDCREN-TC--TNLKYPSASA----------------VAYF 54

  Fly    77 NDNHIPYLNREEFSTLGLLNLQRIYLKKSEVQYIHKESFRNLKILVEIDLSDNKLEMLDKDTFMG 141
            ::|...:|.:.|          .:.|..|::..:.::.|.||..|||..:.:.:|:.::...|.|
  Fly    55 SENVTKHLRKYE----------TLVLHSSDLANLPRKIFLNLPQLVEFHVLECELQQIESVCFDG 109

  Fly   142 NDRLRILYLNGNPLKRLAAYQFPILPHLRTLDMHDCLISYIDPMSLANLNLLEFLNLKNNLLESL 206
            ...|:.|...||.|:.|.:..|.:...|..|::.|..:..:.......|..|:.:||.||.|.:|
  Fly   110 AKNLKRLNFGGNALRVLDSNTFELATQLEELNLSDNQLEDLPTTIFRPLKNLQKINLSNNRLITL 174

  Fly   207 SEYVFQHMANLKTLSLEEN 225
            |:::|..:.:||:::::.|
  Fly   175 SQHIFSQLGSLKSINVDSN 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek6NP_001263151.1 leucine-rich repeat 71..96 CDD:275380 4/24 (17%)
LRR_8 96..155 CDD:290566 15/58 (26%)
leucine-rich repeat 97..120 CDD:275380 5/22 (23%)
leucine-rich repeat 121..144 CDD:275380 6/22 (27%)
LRR_4 144..186 CDD:289563 10/41 (24%)
leucine-rich repeat 145..168 CDD:275380 7/22 (32%)
leucine-rich repeat 169..216 CDD:275380 13/46 (28%)
LRRCT 225..274 CDD:214507 1/1 (100%)
Ig 295..367 CDD:143165
CG5810NP_650952.2 leucine-rich repeat 65..88 CDD:275380 6/32 (19%)
LRR_8 87..147 CDD:290566 16/59 (27%)
leucine-rich repeat 89..112 CDD:275380 6/22 (27%)
leucine-rich repeat 113..136 CDD:275380 7/22 (32%)
LRR_8 135..195 CDD:290566 16/59 (27%)
LRR_4 135..175 CDD:289563 10/39 (26%)
leucine-rich repeat 137..160 CDD:275380 4/22 (18%)
leucine-rich repeat 161..184 CDD:275380 9/22 (41%)
leucine-rich repeat 185..209 CDD:275380 3/9 (33%)
leucine-rich repeat 210..231 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453620
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.