DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek6 and cDIP

DIOPT Version :9

Sequence 1:NP_001263151.1 Gene:kek6 / 43729 FlyBaseID:FBgn0039862 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_650951.1 Gene:cDIP / 42512 FlyBaseID:FBgn0038865 Length:554 Species:Drosophila melanogaster


Alignment Length:426 Identity:94/426 - (22%)
Similarity:156/426 - (36%) Gaps:112/426 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 ELQVLVLNDNHIPYLNREEFSTLGLLNLQRIYLKKSEVQYIHKESFRNLKILVEIDLSDNKLEML 134
            :|.:|:|:||||..|..:.|...|  ||:.|:|.::::..:...:|.||..|..:||::|:||.|
  Fly   142 KLVILLLSDNHIEVLPTKTFRGAG--NLEFIFLNRNKLGKLQAGAFDNLLKLQYLDLTENRLEAL 204

  Fly   135 DKDTFMGNDRLRILYLNGNPLKRLAAYQFPILPHLRTLDMHDCLISYIDPMSLANLNLLEFLNLK 199
            ..|.|.|...||.:.|.||.|..:.:..|...|               |.:|:|         ::
  Fly   205 AADVFAGLKSLRHVGLAGNQLTTIESDLFAHNP---------------DLLSVA---------MQ 245

  Fly   200 NNLLESLSEYVFQHMA---NLKTLSLEENPW---------QCNCKLRKFRGWYVNSRLSSVSLVC 252
            ||.|..:.||.|:...   .::.:.|..||.         ..|...|       |..|..|:|. 
  Fly   246 NNRLREVGEYAFRSRGRHHQMQYVDLSNNPELVVLLLNINATNLTAR-------NCSLDRVNLY- 302

  Fly   253 KGPPAQKDRTWDSVDDELFGCPPRVE---IFNNEEVQ-----------NIDIGSNTTFSCLVYGD 303
             |.....|.:.:.|.:..|.....:|   :.||..||           ::|:..|.....|..|.
  Fly   303 -GSVTNVDLSDNRVRELYFPASEALEHLVLRNNSLVQLASLSRVPRLRHLDVADNPNLGQLPDGW 366

  Fly   304 PLPEVAWELNGKILDNDNVL-FESESIASDKLWSNLTVF--NVTSLDAGTYACTGSNSIGSMTQN 365
            ..|    .|...:|.|...: ...|::...:....|.:.  |:|.:|...:.        ::||.
  Fly   367 RTP----HLEMLVLRNTGQMELPLEALQGMQNLQKLDISGNNLTEIDPSAFP--------TLTQL 419

  Fly   366 ISIYLSEIVQHVLEKTPETFWYFGLIMGIFGTVFLLISISFVV----------------CLCKRT 414
            ...|:.           ...|....:..|...:.....|::.|                |:    
  Fly   420 THFYIH-----------GNNWNCFSLRNIMDVLIRANGIAYTVDNYDPDFPGEYFHGIACM---- 469

  Fly   415 TRQHRHANKAGVKSSVSFNDQEKKLLDSSVTTTTND 450
               :|...|.||.||.|  .:....::||..|:::|
  Fly   470 ---YRLPEKEGVDSSSS--SEISASVESSPITSSSD 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek6NP_001263151.1 leucine-rich repeat 71..96 CDD:275380 10/24 (42%)
LRR_8 96..155 CDD:290566 22/58 (38%)
leucine-rich repeat 97..120 CDD:275380 6/22 (27%)
leucine-rich repeat 121..144 CDD:275380 10/22 (45%)
LRR_4 144..186 CDD:289563 9/41 (22%)
leucine-rich repeat 145..168 CDD:275380 7/22 (32%)
leucine-rich repeat 169..216 CDD:275380 9/49 (18%)
LRRCT 225..274 CDD:214507 12/57 (21%)
Ig 295..367 CDD:143165 13/74 (18%)
cDIPNP_650951.1 leucine-rich repeat 118..142 CDD:275380 94/426 (22%)
LRR_RI 143..407 CDD:238064 73/302 (24%)
leucine-rich repeat 143..166 CDD:275380 10/24 (42%)
LRR_8 166..225 CDD:290566 22/58 (38%)
leucine-rich repeat 167..190 CDD:275380 6/22 (27%)
leucine-rich repeat 191..214 CDD:275380 10/22 (45%)
leucine-rich repeat 215..238 CDD:275380 8/37 (22%)
leucine-rich repeat 239..265 CDD:275380 8/34 (24%)
leucine-rich repeat 266..325 CDD:275380 13/67 (19%)
LRR_8 304..357 CDD:290566 9/52 (17%)
leucine-rich repeat 326..347 CDD:275380 5/20 (25%)
leucine-rich repeat 348..394 CDD:275380 9/49 (18%)
LRR_8 369..428 CDD:290566 12/81 (15%)
LRR_4 393..433 CDD:289563 8/58 (14%)
leucine-rich repeat 395..418 CDD:275380 4/30 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453735
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.