DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek6 and CG18249

DIOPT Version :10

Sequence 1:NP_001263151.1 Gene:kek6 / 43729 FlyBaseID:FBgn0039862 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_001163549.1 Gene:CG18249 / 40964 FlyBaseID:FBgn0037553 Length:559 Species:Drosophila melanogaster


Alignment Length:207 Identity:57/207 - (27%)
Similarity:92/207 - (44%) Gaps:30/207 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VCWILLCL------------VAWTVADDWSLSCASNCTCKWTNGKKSAICSSLQLTTIPNTLSTE 70
            :.|::|.|            ..:.::.: ||....|.|.....|....:........:|     .
  Fly    70 ITWLVLQLTPGLRTLVIRNCATYHISKE-SLRPVENLTSLQMQGTSLGVLRDQIFNAVP-----R 128

  Fly    71 LQVLVLNDNHIPYLNREEFSTLGLLNLQRIYLKKSEVQYIHKESFRNLKILVEIDLSDNKLEMLD 135
            |::|.|:.|.|..::...|.  ||..|:.:.|:.:.:..|...:...|..||.:|||.|:|..|.
  Fly   129 LEILQLSQNFIHTVHVAAFQ--GLSKLRLLGLQGNAIAEILSSTLDPLMELVHLDLSRNELTTLP 191

  Fly   136 KDTFMGNDRLRILYLNGNPLKRLAAYQFPILPHLRTLDMHDCLISYIDPMSLANLNLLEFLNLKN 200
            ::.|..|.:|:.|.||||||:.|.......||:||.||     :.:...:.:..|||   .|::|
  Fly   192 QNIFAKNKKLQTLLLNGNPLRILMPDVLGSLPNLRLLD-----LGHAAELEVMTLNL---TNVQN 248

  Fly   201 NLLE--SLSEYV 210
            .:||  |||..|
  Fly   249 LVLEGSSLSSLV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek6NP_001263151.1 LRR <56..>226 CDD:443914 49/157 (31%)
leucine-rich repeat 71..96 CDD:275380 8/24 (33%)
LRR_8 96..155 CDD:404697 20/58 (34%)
leucine-rich repeat 97..120 CDD:275380 4/22 (18%)
leucine-rich repeat 121..144 CDD:275380 10/22 (45%)
leucine-rich repeat 145..168 CDD:275380 10/22 (45%)
leucine-rich repeat 169..216 CDD:275380 15/44 (34%)
LRRCT 225..274 CDD:214507
Ig 286..360 CDD:472250
Ig strand B 294..298 CDD:409353
Ig strand C 307..310 CDD:409353
Ig strand E 336..340 CDD:409353
Ig strand F 350..355 CDD:409353
CG18249NP_001163549.1 leucine-rich repeat 57..80 CDD:275380 3/9 (33%)
LRR 105..433 CDD:443914 51/171 (30%)
leucine-rich repeat 105..128 CDD:275380 3/27 (11%)
leucine-rich repeat 129..152 CDD:275380 8/24 (33%)
leucine-rich repeat 153..176 CDD:275380 4/22 (18%)
leucine-rich repeat 177..200 CDD:275380 10/22 (45%)
leucine-rich repeat 201..224 CDD:275380 10/22 (45%)
leucine-rich repeat 225..258 CDD:275380 13/40 (33%)
leucine-rich repeat 259..310 CDD:275380 1/2 (50%)
leucine-rich repeat 311..344 CDD:275380
leucine-rich repeat 345..368 CDD:275380
leucine-rich repeat 369..390 CDD:275380
leucine-rich repeat 393..417 CDD:275380
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.