Sequence 1: | NP_001263151.1 | Gene: | kek6 / 43729 | FlyBaseID: | FBgn0039862 | Length: | 843 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001163549.1 | Gene: | CG18249 / 40964 | FlyBaseID: | FBgn0037553 | Length: | 559 | Species: | Drosophila melanogaster |
Alignment Length: | 207 | Identity: | 57/207 - (27%) |
---|---|---|---|
Similarity: | 92/207 - (44%) | Gaps: | 30/207 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 VCWILLCL------------VAWTVADDWSLSCASNCTCKWTNGKKSAICSSLQLTTIPNTLSTE 70
Fly 71 LQVLVLNDNHIPYLNREEFSTLGLLNLQRIYLKKSEVQYIHKESFRNLKILVEIDLSDNKLEMLD 135
Fly 136 KDTFMGNDRLRILYLNGNPLKRLAAYQFPILPHLRTLDMHDCLISYIDPMSLANLNLLEFLNLKN 200
Fly 201 NLLE--SLSEYV 210 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kek6 | NP_001263151.1 | leucine-rich repeat | 71..96 | CDD:275380 | 8/24 (33%) |
LRR_8 | 96..155 | CDD:290566 | 20/58 (34%) | ||
leucine-rich repeat | 97..120 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 121..144 | CDD:275380 | 10/22 (45%) | ||
LRR_4 | 144..186 | CDD:289563 | 15/41 (37%) | ||
leucine-rich repeat | 145..168 | CDD:275380 | 10/22 (45%) | ||
leucine-rich repeat | 169..216 | CDD:275380 | 15/44 (34%) | ||
LRRCT | 225..274 | CDD:214507 | |||
Ig | 295..367 | CDD:143165 | |||
CG18249 | NP_001163549.1 | leucine-rich repeat | 57..80 | CDD:275380 | 3/9 (33%) |
LRR_8 | 104..163 | CDD:290566 | 14/65 (22%) | ||
leucine-rich repeat | 105..128 | CDD:275380 | 3/27 (11%) | ||
LRR_RI | 107..438 | CDD:238064 | 50/169 (30%) | ||
leucine-rich repeat | 129..152 | CDD:275380 | 8/24 (33%) | ||
leucine-rich repeat | 153..176 | CDD:275380 | 4/22 (18%) | ||
LRR_8 | 176..232 | CDD:290566 | 25/60 (42%) | ||
leucine-rich repeat | 177..200 | CDD:275380 | 10/22 (45%) | ||
leucine-rich repeat | 201..224 | CDD:275380 | 10/22 (45%) | ||
leucine-rich repeat | 225..258 | CDD:275380 | 13/40 (33%) | ||
leucine-rich repeat | 259..310 | CDD:275380 | 1/2 (50%) | ||
leucine-rich repeat | 311..344 | CDD:275380 | |||
LRR_8 | 343..403 | CDD:290566 | |||
leucine-rich repeat | 345..368 | CDD:275380 | |||
leucine-rich repeat | 369..390 | CDD:275380 | |||
leucine-rich repeat | 393..417 | CDD:275380 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45453734 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |