Sequence 1: | NP_001263151.1 | Gene: | kek6 / 43729 | FlyBaseID: | FBgn0039862 | Length: | 843 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001246846.1 | Gene: | Toll-9 / 40245 | FlyBaseID: | FBgn0036978 | Length: | 900 | Species: | Drosophila melanogaster |
Alignment Length: | 540 | Identity: | 96/540 - (17%) |
---|---|---|---|
Similarity: | 168/540 - (31%) | Gaps: | 229/540 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 97 LQRIYLKKSEVQYIHKESFRNLKILVEIDLSDNKLEMLDKDTFMGNDRLRILYLNGNPLKRLA-- 159
Fly 160 -----AYQ----------------------FPILPHLRTLDMHDCLISYIDPMSLANL-NLLEFL 196
Fly 197 NL-------------KNNLLESLS-----------------------EYVFQHMANLKTLSLEEN 225
Fly 226 PWQCNCKLRKFRG--------------------------------WY-----VNSRLSSVSLVCK 253
Fly 254 GPPAQKDRTWDSVDDELFGCPPRVEIFNNEEVQNIDIGSNTTFSCLVYGDPLPEVAWELNGKILD 318
Fly 319 -------------NDNVLFESESIASD-KLW------------SNLTVFN--------------- 342
Fly 343 -------------------------VTSLDAGTYACTGSN----------SIGSMTQNISIYLSE 372
Fly 373 IVQHVLEKTPETFWYFGLIMGIFGTVFLLISISFVVCLCKRTTRQHRHANKAGVKSSVSFNDQEK 437
Fly 438 KLLDSSVTTTTNDRGDSYGI 457 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kek6 | NP_001263151.1 | leucine-rich repeat | 71..96 | CDD:275380 | |
LRR_8 | 96..155 | CDD:290566 | 17/57 (30%) | ||
leucine-rich repeat | 97..120 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 121..144 | CDD:275380 | 8/22 (36%) | ||
LRR_4 | 144..186 | CDD:289563 | 11/70 (16%) | ||
leucine-rich repeat | 145..168 | CDD:275380 | 7/51 (14%) | ||
leucine-rich repeat | 169..216 | CDD:275380 | 15/83 (18%) | ||
LRRCT | 225..274 | CDD:214507 | 11/85 (13%) | ||
Ig | 295..367 | CDD:143165 | 25/147 (17%) | ||
Toll-9 | NP_001246846.1 | leucine-rich repeat | 157..185 | CDD:275380 | |
LRR_8 | 262..322 | CDD:290566 | 18/65 (28%) | ||
leucine-rich repeat | 264..287 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 288..311 | CDD:275380 | 9/30 (30%) | ||
leucine-rich repeat | 312..356 | CDD:275380 | 5/43 (12%) | ||
LRR_8 | <344..387 | CDD:290566 | 11/42 (26%) | ||
leucine-rich repeat | 357..381 | CDD:275380 | 5/23 (22%) | ||
leucine-rich repeat | 382..397 | CDD:275380 | 4/14 (29%) | ||
leucine-rich repeat | 405..430 | CDD:275380 | 3/24 (13%) | ||
LRR_8 | 431..488 | CDD:290566 | 7/61 (11%) | ||
leucine-rich repeat | 432..453 | CDD:275380 | 5/25 (20%) | ||
LRR_RI | <449..536 | CDD:238064 | 13/103 (13%) | ||
leucine-rich repeat | 454..477 | CDD:275380 | 1/22 (5%) | ||
LRR_8 | 477..536 | CDD:290566 | 11/75 (15%) | ||
leucine-rich repeat | 478..501 | CDD:275380 | 3/22 (14%) | ||
leucine-rich repeat | 502..525 | CDD:275380 | 4/38 (11%) | ||
TIR | 751..891 | CDD:214587 | 2/3 (67%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45453675 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |