DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment kek6 and CG32055

DIOPT Version :9

Sequence 1:	NP_001263151.1	Gene:	kek6 / 43729	FlyBaseID:	FBgn0039862	Length:	843	Species:	Drosophila melanogaster
Sequence 2:	NP_729599.1	Gene:	CG32055 / 39188	FlyBaseID:	FBgn0052055	Length:	534	Species:	Drosophila melanogaster

Alignment Length:	202	Identity:	56/202 - (27%)
Similarity:	91/202 - (45%)	Gaps:	31/202 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly    70 ELQVLVLNDNHIPYLNREEFSTLGLLNLQRIYLKKSEVQYIHKESFRNLKILVEIDLSDNKLEML 134
            :|:.|.|..|.|..::...|  |||.:||.::|:.:::..:..:.|.||..|.::|||.|.::.|
  Fly   291 KLRTLNLWLNQINRIHPRAF--LGLSSLQTLHLQGNKISILPDDVFANLTALEKLDLSKNNIQKL 353

  Fly   135 DKDTFMGNDRLRILYLN--------------------------GNPLKRLAAYQFPILPHLRTLD 173
            ....|......:::||:                          .|.|..|....|..|..|:.|.
  Fly   354 GLRVFGERILRKLIYLDLSNNYIADLHPLALSSMPFIKELRLRRNRLVSLDLRMFAPLRQLQLLT 418

  Fly   174 MHDCLISYIDPMSLANLNLLEFLNLKNNLLESLSEY-VFQHMANLKTLSLEENPWQCNCKLRKFR 237
            :::..:..||...|..|:.|..|.|.||.|..|.:. ..|::..|:.::||.|||||.| |.:..
  Fly   419 INENRLEEIDGEILDTLDRLNHLELNNNRLTFLPDLKSSQNLLQLRNITLEGNPWQCLC-LDEIT 482

  Fly   238 GWYVNSR 244
            .| :|.|
  Fly   483 SW-LNGR 488

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
kek6	NP_001263151.1	leucine-rich repeat	71..96	CDD:275380	9/24 (38%)
		LRR_8	96..155	CDD:290566	16/84 (19%)
		leucine-rich repeat	97..120	CDD:275380	6/22 (27%)
		leucine-rich repeat	121..144	CDD:275380	7/22 (32%)
		LRR_4	144..186	CDD:289563	11/67 (16%)
		leucine-rich repeat	145..168	CDD:275380	7/48 (15%)
		leucine-rich repeat	169..216	CDD:275380	14/47 (30%)
		LRRCT	225..274	CDD:214507	10/20 (50%)
		Ig	295..367	CDD:143165
CG32055	NP_729599.1	leucine-rich repeat	76..99	CDD:275380
		leucine-rich repeat	100..123	CDD:275380
		LRR_8	128..180	CDD:290566
		leucine-rich repeat	128..147	CDD:275380
		leucine-rich repeat	148..171	CDD:275380
		leucine-rich repeat	172..192	CDD:275380
		LRR_RI	<187..400	CDD:238064	25/110 (23%)
		LRR_8	192..251	CDD:290566
		leucine-rich repeat	193..216	CDD:275380
		leucine-rich repeat	217..240	CDD:275380
		leucine-rich repeat	241..267	CDD:275380
		leucine-rich repeat	268..291	CDD:275380	56/202 (28%)
		LRR_8	290..350	CDD:290566	20/60 (33%)
		leucine-rich repeat	292..315	CDD:275380	9/24 (38%)
		leucine-rich repeat	316..339	CDD:275380	6/22 (27%)
		LRR_8	340..400	CDD:290566	10/59 (17%)
		leucine-rich repeat	340..365	CDD:275380	7/24 (29%)
		leucine-rich repeat	366..389	CDD:275380	2/22 (9%)
		leucine-rich repeat	390..413	CDD:275380	5/22 (23%)
		LRR_8	391..448	CDD:290566	16/56 (29%)
		leucine-rich repeat	414..437	CDD:275380	6/22 (27%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C45453530
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.930