DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek6 and CG6749

DIOPT Version :10

Sequence 1:NP_001263151.1 Gene:kek6 / 43729 FlyBaseID:FBgn0039862 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster


Alignment Length:213 Identity:65/213 - (30%)
Similarity:99/213 - (46%) Gaps:41/213 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LQVLVLNDNHIPYLNREEFSTLGLLNLQRIYLKKSEVQYIHKESFRNLKILVEIDLSDNKLEMLD 135
            ||:|.::.|.|..|:...|  :||.:|:::||:.:.:..|...:|..|..|..:|||.|.||.|:
  Fly   296 LQMLDVSRNSIASLSPAHF--VGLGSLRKLYLQYNAILEIKPATFAALLNLDTLDLSYNNLEFLE 358

  Fly   136 KDTFMGN--DRLRILYLNGNPLKRLAAYQFPILPHLRTLDMHDCLISYIDPMSLANLNLLEFLNL 198
            :..|.||  .|:|.|.||||.:|.|....|..||.|..|.:....:..:|....|.:..|:.|:|
  Fly   359 EQIFGGNTLPRMRRLNLNGNRMKHLHPLAFSSLPFLEYLKLGHNELKSLDVRMFAPMRRLQKLHL 423

  Fly   199 KNNLLESLSEYVFQHMA-----------------------NLKTLSLEENPWQCNC--------- 231
            .:||||.::..|.:.::                       |||.:::|.|||||.|         
  Fly   424 GHNLLEEINLDVLESLSSVQEILVDNNRLTFLAKVNVSFPNLKRVAIEGNPWQCPCFVKLQHWLA 488

  Fly   232 -----KLRKFRGWYVNSR 244
                 .||...|:|...|
  Fly   489 TRDVVYLRDNTGYYKGER 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek6NP_001263151.1 LRR <56..>226 CDD:443914 54/179 (30%)
leucine-rich repeat 71..96 CDD:275380 9/24 (38%)
LRR_8 96..155 CDD:404697 24/60 (40%)
leucine-rich repeat 97..120 CDD:275380 6/22 (27%)
leucine-rich repeat 121..144 CDD:275380 11/24 (46%)
leucine-rich repeat 145..168 CDD:275380 10/22 (45%)
leucine-rich repeat 169..216 CDD:275380 12/69 (17%)
LRRCT 225..274 CDD:214507 11/34 (32%)
Ig 286..360 CDD:472250
Ig strand B 294..298 CDD:409353
Ig strand C 307..310 CDD:409353
Ig strand E 336..340 CDD:409353
Ig strand F 350..355 CDD:409353
CG6749NP_648354.1 LRR_8 104..164 CDD:404697
leucine-rich repeat 106..129 CDD:275380
leucine-rich repeat 130..153 CDD:275380
leucine-rich repeat 154..195 CDD:275380
leucine-rich repeat 196..219 CDD:275380
LRR 199..>452 CDD:443914 50/157 (32%)
leucine-rich repeat 220..243 CDD:275380
leucine-rich repeat 244..267 CDD:275380
leucine-rich repeat 272..295 CDD:275380
leucine-rich repeat 296..319 CDD:275380 9/24 (38%)
leucine-rich repeat 320..343 CDD:275380 6/22 (27%)
leucine-rich repeat 344..369 CDD:275380 11/24 (46%)
leucine-rich repeat 370..393 CDD:275380 10/22 (45%)
leucine-rich repeat 394..417 CDD:275380 4/22 (18%)
leucine-rich repeat 418..441 CDD:275380 8/22 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.