DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek6 and CG6749

DIOPT Version :9

Sequence 1:NP_001263151.1 Gene:kek6 / 43729 FlyBaseID:FBgn0039862 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster


Alignment Length:213 Identity:65/213 - (30%)
Similarity:99/213 - (46%) Gaps:41/213 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LQVLVLNDNHIPYLNREEFSTLGLLNLQRIYLKKSEVQYIHKESFRNLKILVEIDLSDNKLEMLD 135
            ||:|.::.|.|..|:...|  :||.:|:::||:.:.:..|...:|..|..|..:|||.|.||.|:
  Fly   296 LQMLDVSRNSIASLSPAHF--VGLGSLRKLYLQYNAILEIKPATFAALLNLDTLDLSYNNLEFLE 358

  Fly   136 KDTFMGN--DRLRILYLNGNPLKRLAAYQFPILPHLRTLDMHDCLISYIDPMSLANLNLLEFLNL 198
            :..|.||  .|:|.|.||||.:|.|....|..||.|..|.:....:..:|....|.:..|:.|:|
  Fly   359 EQIFGGNTLPRMRRLNLNGNRMKHLHPLAFSSLPFLEYLKLGHNELKSLDVRMFAPMRRLQKLHL 423

  Fly   199 KNNLLESLSEYVFQHMA-----------------------NLKTLSLEENPWQCNC--------- 231
            .:||||.::..|.:.::                       |||.:::|.|||||.|         
  Fly   424 GHNLLEEINLDVLESLSSVQEILVDNNRLTFLAKVNVSFPNLKRVAIEGNPWQCPCFVKLQHWLA 488

  Fly   232 -----KLRKFRGWYVNSR 244
                 .||...|:|...|
  Fly   489 TRDVVYLRDNTGYYKGER 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek6NP_001263151.1 leucine-rich repeat 71..96 CDD:275380 9/24 (38%)
LRR_8 96..155 CDD:290566 24/60 (40%)
leucine-rich repeat 97..120 CDD:275380 6/22 (27%)
leucine-rich repeat 121..144 CDD:275380 11/24 (46%)
LRR_4 144..186 CDD:289563 15/41 (37%)
leucine-rich repeat 145..168 CDD:275380 10/22 (45%)
leucine-rich repeat 169..216 CDD:275380 12/69 (17%)
LRRCT 225..274 CDD:214507 11/34 (32%)
Ig 295..367 CDD:143165
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064
LRR_8 104..164 CDD:290566
leucine-rich repeat 106..129 CDD:275380
leucine-rich repeat 130..153 CDD:275380
leucine-rich repeat 154..195 CDD:275380
LRR_RI 194..455 CDD:238064 50/160 (31%)
LRR_8 194..254 CDD:290566
leucine-rich repeat 196..219 CDD:275380
leucine-rich repeat 220..243 CDD:275380
leucine-rich repeat 244..267 CDD:275380
LRR_8 271..330 CDD:290566 12/35 (34%)
leucine-rich repeat 272..295 CDD:275380
leucine-rich repeat 296..319 CDD:275380 9/24 (38%)
LRR_8 319..380 CDD:290566 24/60 (40%)
leucine-rich repeat 320..343 CDD:275380 6/22 (27%)
leucine-rich repeat 344..369 CDD:275380 11/24 (46%)
LRR_8 368..428 CDD:290566 20/59 (34%)
leucine-rich repeat 370..393 CDD:275380 10/22 (45%)
leucine-rich repeat 394..417 CDD:275380 4/22 (18%)
leucine-rich repeat 418..441 CDD:275380 8/22 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453526
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.