DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek6 and Lapsyn

DIOPT Version :9

Sequence 1:NP_001263151.1 Gene:kek6 / 43729 FlyBaseID:FBgn0039862 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_611561.1 Gene:Lapsyn / 37418 FlyBaseID:FBgn0034602 Length:343 Species:Drosophila melanogaster


Alignment Length:450 Identity:96/450 - (21%)
Similarity:151/450 - (33%) Gaps:142/450 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TLPVCWILLCLVAWTVADDWSLSCASNCTCKWTNGKKSAICSSLQLTTIPNTLSTELQVLVLNDN 79
            |..||..||....:.:..:     ...||....:......|..|.|..:|..|.:.::||.|:.|
  Fly     9 TFIVCLQLLHSAGFIIQSE-----VRKCTYGHIDKLLRIRCYDLDLKEVPQNLKSSVEVLDLSHN 68

  Fly    80 HIPYLNREEFSTLGLLNLQRIYLKKSEVQYIHKESFRNLKILVEIDLSDNKLEMLDKDTFMGNDR 144
            .|..|....|..  ..:::.:.|..:.:..:...:|..|..|.|||||:|.|..:..:.|.    
  Fly    69 RIRKLKTSSFQR--YTDIKFLMLYDNMILSVEVGTFEPLTSLQEIDLSNNGLTTIPLELFQ---- 127

  Fly   145 LRILYLNGNPLKRLAAYQFPILPHLRTLDMHDCLISYIDPMSLANLNL----------LEFLNLK 199
                                 ||.||.|        |||...|.:|||          ||:||:.
  Fly   128 ---------------------LPRLRNL--------YIDSNELTSLNLQALEKPIRAPLEYLNVA 163

  Fly   200 NNLLESLSEYVFQHMANLKTLSLEENPWQCNCKLRKFRGWYVNSRLSSVSLVCKGPPAQKDRTWD 264
            ...|:.|.:           |.:....||.|..:...:    |.|:.|::.:|      ..:..|
  Fly   164 GCELQELPD-----------LGILPKLWQLNASMNPLQ----NFRIDSLANMC------HLQVID 207

  Fly   265 SVDDELFGCPPRVEIFNNEEVQN--IDIGSNTTFSCLVYGDPLPEVAWELNGKILDNDNVLFESE 327
            ....:|..|       ..::|.|  :.:|::..|        :|               |..|:.
  Fly   208 LTKSQLSQC-------GCQQVTNHLMMLGASPKF--------VP---------------VCLEAL 242

  Fly   328 SIASDKLWSNLTVFNVTSLDAGTYACTGSNSIGSMTQNISIYLSEIVQHVLEKTPETFWYFGLIM 392
            .|....|..|.|:.:.|.....|                ::..:|         ..:||.||  .
  Fly   243 DIRECPLPYNRTIHSPTFASCQT----------------TLQFAE---------TRSFWLFG--A 280

  Fly   393 GIFGTV-FLLISISFVVCLCKRTTRQHRHANKAGVKSSVSFNDQEKKLLDSSVTTTTNDR 451
            |.||.| |:|:.:.|.|..|:|...|.|..|.           |::|....|.....|:|
  Fly   281 GCFGGVCFVLLIVIFCVIHCRRKRAQRRKRNA-----------QKRKPFVISPRNAINNR 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek6NP_001263151.1 leucine-rich repeat 71..96 CDD:275380 7/24 (29%)
LRR_8 96..155 CDD:290566 12/58 (21%)
leucine-rich repeat 97..120 CDD:275380 3/22 (14%)
leucine-rich repeat 121..144 CDD:275380 9/22 (41%)
LRR_4 144..186 CDD:289563 8/41 (20%)
leucine-rich repeat 145..168 CDD:275380 1/22 (5%)
leucine-rich repeat 169..216 CDD:275380 16/56 (29%)
LRRCT 225..274 CDD:214507 9/48 (19%)
Ig 295..367 CDD:143165 10/71 (14%)
LapsynNP_611561.1 leucine-rich repeat 39..59 CDD:275380 5/19 (26%)
LRR_8 58..118 CDD:290566 17/61 (28%)
leucine-rich repeat 60..83 CDD:275380 7/24 (29%)
leucine-rich repeat 84..107 CDD:275380 3/22 (14%)
LRR_RI <94..>249 CDD:238064 48/238 (20%)
LRR_8 106..167 CDD:290566 25/93 (27%)
LRR_4 106..145 CDD:289563 18/71 (25%)
leucine-rich repeat 108..130 CDD:275380 10/46 (22%)
leucine-rich repeat 131..154 CDD:275380 10/30 (33%)
leucine-rich repeat 157..178 CDD:275380 7/31 (23%)
leucine-rich repeat 179..202 CDD:275380 7/32 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24366
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.