DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek6 and Lrrc24

DIOPT Version :9

Sequence 1:NP_001263151.1 Gene:kek6 / 43729 FlyBaseID:FBgn0039862 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_001129368.1 Gene:Lrrc24 / 362945 RGDID:1308720 Length:521 Species:Rattus norvegicus


Alignment Length:448 Identity:114/448 - (25%)
Similarity:186/448 - (41%) Gaps:73/448 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 CASNCTCKWTNGKKSAICSSLQLTTIPNTLSTELQVLVLNDNHIPYLNREEFSTLGLLNLQRIYL 102
            |.:.|.|.    ..:..|.:|:|..:|..:....|.|.|.||.|.:|  |:.:...|..|:.:||
  Rat    31 CPAACRCY----SATVECGALRLRVVPPGIPPGTQTLFLQDNSIAHL--EQGALAPLAALRHLYL 89

  Fly   103 KKSEVQYIHKESFRNLKILVEIDLSDNKLEMLDKDTFMGNDRLRILYLNGNPLKRLAAYQFPILP 167
            ..:.::.:...:||....|:|:.|:.|:|..|....|:|..:||:|||.||.|.:|..:.|..||
  Rat    90 HNNTLRALESGAFRAQPRLLELALTGNRLRGLRGGAFVGLVQLRVLYLAGNQLAKLLDFTFLHLP 154

  Fly   168 HLRTLDMHDCLISYIDPMSLANLNLLEFLNLKNNLLESLSEYVFQHMANLKTLSLEENPWQCNCK 232
            .|:.|.:.:..|..::..:||.|:.|..|:|..|.|.::|:...|.:::|:.|.|.||||:|:|.
  Rat   155 RLQELHLQENSIELLEDQALAGLSSLALLDLSRNQLGTISKEALQPLSSLQVLRLTENPWRCDCA 219

  Fly   233 LRKFRGW-------YVNSRLSSVSLVCKGPPAQKDRTWDSVDDELFGC-PPRVEIFNNEEVQNID 289
            |.....|       .::||  ...:.|..||....::...|......| ||.|.....|...|  
  Rat   220 LHWLGSWIKEGGRRLLSSR--DKKITCAEPPRLALQSLLEVSGGSLICIPPSVNAEPPELTAN-- 280

  Fly   290 IGSNTTFSCLVYGDPLPEVAWE-----LNGKILDNDNVLFESES------IASDKLWSNLTVFNV 343
            :|.:...:|...|.|.|.|.|.     .:||  ....|..|..:      ...|.....|.:.|:
  Rat   281 LGEDLQVACQASGYPQPLVVWRKMLQPRDGK--PQAQVQLEGGAPGLGGHATRDTGSGMLFLTNI 343

  Fly   344 TSLDAGTYACTGSNSIGSMTQNISIYLSEIVQHVL-------------EKTPET----------- 384
            |...||.|.|..:|:.|.         :.::.|:|             .:.|.|           
  Rat   344 TLAHAGKYECEATNAGGK---------ARVLFHLLVNASRQQSQQLPAPQAPATRPVGQEPQHEG 399

  Fly   385 ----FWYFGLI--MGIFGTVFL--LISISFVVCLCKRTTRQHRHANKAGVKSSVSFND 434
                |...||.  ..|...:.|  |.::.....:|:|..|:.:....:| :.::..||
  Rat   400 GSMAFRALGLATQTAITAAIALLALTALLLAAMICRRRRRRKKMPVPSG-EGTLFVND 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek6NP_001263151.1 leucine-rich repeat 71..96 CDD:275380 9/24 (38%)
LRR_8 96..155 CDD:290566 20/58 (34%)
leucine-rich repeat 97..120 CDD:275380 5/22 (23%)
leucine-rich repeat 121..144 CDD:275380 8/22 (36%)
LRR_4 144..186 CDD:289563 15/41 (37%)
leucine-rich repeat 145..168 CDD:275380 11/22 (50%)
leucine-rich repeat 169..216 CDD:275380 13/46 (28%)
LRRCT 225..274 CDD:214507 14/56 (25%)
Ig 295..367 CDD:143165 20/82 (24%)
Lrrc24NP_001129368.1 leucine-rich repeat 61..83 CDD:275380 9/23 (39%)
PPP1R42 63..>212 CDD:411060 49/150 (33%)
LRR_8 84..142 CDD:404697 20/57 (35%)
leucine-rich repeat 84..107 CDD:275380 5/22 (23%)
leucine-rich repeat 108..131 CDD:275380 8/22 (36%)
leucine-rich repeat 132..155 CDD:275380 11/22 (50%)
leucine-rich repeat 156..179 CDD:275380 6/22 (27%)
leucine-rich repeat 180..203 CDD:275380 7/22 (32%)
PCC 188..>259 CDD:188093 20/72 (28%)
Ig_3 267..357 CDD:404760 24/93 (26%)
Ig strand A 267..271 CDD:409353 2/3 (67%)
Ig strand A' 276..280 CDD:409353 1/3 (33%)
Ig strand B 283..292 CDD:409353 1/8 (13%)
Ig strand C 298..304 CDD:409353 2/5 (40%)
Ig strand D 330..333 CDD:409353 0/2 (0%)
Ig strand E 336..342 CDD:409353 1/5 (20%)
Ig strand F 349..357 CDD:409353 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I4399
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45224
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24366
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
77.020

Return to query results.
Submit another query.