DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek6 and LINGO4

DIOPT Version :9

Sequence 1:NP_001263151.1 Gene:kek6 / 43729 FlyBaseID:FBgn0039862 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_001004432.1 Gene:LINGO4 / 339398 HGNCID:31814 Length:593 Species:Homo sapiens


Alignment Length:550 Identity:111/550 - (20%)
Similarity:179/550 - (32%) Gaps:204/550 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SCASNCTCKWTNGKKSAICSSLQLTTIPNTLSTELQVLVLNDNHIPYLNREEFSTLGLLNLQRIY 101
            ||.:.|.|  |:..::.:|...||..:|..|..:.::|.|:.|.:..|.:...|.|.|  ||.:.
Human    30 SCPAVCDC--TSQPQAVLCGHRQLEAVPGGLPLDTELLDLSGNRLWGLQQGMLSRLSL--LQELD 90

  Fly   102 LKKSEVQYIHKESFRNLKILVEIDLSDNKLEMLDKDTFMGNDRLR---------ILYLNG----- 152
            |..:::..:...:|..|:.|:.:.|..|:|.::....|.|...|.         :|:|:|     
Human    91 LSYNQLSTLEPGAFHGLQSLLTLRLQGNRLRIMGPGVFSGLSALTLLDLRLNQIVLFLDGAFGEL 155

  Fly   153 ----------NPLKRLAAYQFPILPHLRTLDMHDCLISYI------------------------- 182
                      |.|..:|...|..|..|.||.:..|.:|.:                         
Human   156 GSLQKLEVGDNHLVFVAPGAFAGLAKLSTLTLERCNLSTVPGLALARLPALVALRLRELDIGRLP 220

  Fly   183 ------------------------DPMSLANLNL--------------------LEF-------- 195
                                    ||.||..|||                    |.|        
Human   221 AGALRGLGQLKELEIHLWPSLEALDPGSLVGLNLSSLAITRCNLSSVPFQALYHLSFLRVLDLSQ 285

  Fly   196 -------------------------------------------LNLKNNLLESLSEYVFQHMANL 217
                                                       |::.:|.|::|.|..|.....|
Human   286 NPISAIPARRLSPLVRLQELRLSGACLTSIAAHAFHGLTAFHLLDVADNALQTLEETAFPSPDKL 350

  Fly   218 KTLSLEENPWQCNCKLRKFRGWYVNSR----LSSVSLVCKGPPAQKDRTWDSVDDEL----FGCP 274
            .||.|..||..|:|:|.    |.:..|    .......|.||...:.::.....|.|    |.|.
Human   351 VTLRLSGNPLTCDCRLL----WLLRLRRHLDFGMSPPACAGPHHVQGKSLKEFSDILPPGHFTCK 411

  Fly   275 PRVEIFNNEEVQNIDIGSNTTFSCLVYGDPLPEVAW-ELNG---------KILDNDNVLFESESI 329
            |.:...:.......:.|.:..|||...|||.|.|:| ..:|         ::|::          
Human   412 PALIRKSGPRWVIAEEGGHAVFSCSGDGDPAPTVSWMRPHGAWLGRAGRVRVLED---------- 466

  Fly   330 ASDKLWSNLTVFNVTSLDAGTYACTGSNSIGSMTQNISIYLSEIVQHVLEKTPETFWYFGL-IMG 393
                  ..|.:.:|...|.|.|.|..||..|:  .::..:| |::|  :|....|.....: :.|
Human   467 ------GTLEIRSVQLRDRGAYVCVVSNVAGN--DSLRTWL-EVIQ--VEPPNGTLSDPNITVPG 520

  Fly   394 IFGTVFL-------LISISFV-----VCLC 411
            |.|..||       ::::.|:     |.||
Human   521 IPGPFFLDSRGVAMVLAVGFLPFLTSVTLC 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek6NP_001263151.1 leucine-rich repeat 71..96 CDD:275380 7/24 (29%)
LRR_8 96..155 CDD:290566 16/82 (20%)
leucine-rich repeat 97..120 CDD:275380 5/22 (23%)
leucine-rich repeat 121..144 CDD:275380 6/22 (27%)
LRR_4 144..186 CDD:289563 16/114 (14%)
leucine-rich repeat 145..168 CDD:275380 9/46 (20%)
leucine-rich repeat 169..216 CDD:275380 20/166 (12%)
LRRCT 225..274 CDD:214507 13/56 (23%)
Ig 295..367 CDD:143165 20/81 (25%)
LINGO4NP_001004432.1 LRRNT 31..64 CDD:214470 9/34 (26%)
leucine-rich repeat 62..85 CDD:275380 6/22 (27%)
LRR_8 65..120 CDD:290566 15/56 (27%)
leucine-rich repeat 86..109 CDD:275380 5/22 (23%)
LRR_RI 87..320 CDD:238064 33/232 (14%)
LRR_8 109..168 CDD:290566 11/58 (19%)
leucine-rich repeat 110..133 CDD:275380 6/22 (27%)
leucine-rich repeat 134..157 CDD:275380 4/22 (18%)
LRR_8 157..212 CDD:290566 10/54 (19%)
leucine-rich repeat 158..181 CDD:275380 5/22 (23%)
leucine-rich repeat 182..205 CDD:275380 5/22 (23%)
leucine-rich repeat 206..229 CDD:275380 0/22 (0%)
leucine-rich repeat 230..277 CDD:275380 8/46 (17%)
LRR_8 253..309 CDD:290566 4/55 (7%)
leucine-rich repeat 278..301 CDD:275380 0/22 (0%)
LRR_8 301..360 CDD:290566 11/58 (19%)
leucine-rich repeat 302..325 CDD:275380 0/22 (0%)
leucine-rich repeat 326..344 CDD:275380 5/17 (29%)
leucine-rich repeat 350..362 CDD:275378 6/11 (55%)
IG_like 420..501 CDD:214653 22/99 (22%)
Ig 431..501 CDD:299845 21/88 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41933
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.