| Sequence 1: | NP_001263151.1 | Gene: | kek6 / 43729 | FlyBaseID: | FBgn0039862 | Length: | 843 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_852045.1 | Gene: | Rtn4rl2 / 311169 | RGDID: | 727797 | Length: | 420 | Species: | Rattus norvegicus |
| Alignment Length: | 319 | Identity: | 85/319 - (26%) |
|---|---|---|---|
| Similarity: | 130/319 - (40%) | Gaps: | 62/319 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 7 RRRSRTPRTLPVCWILLCLVAWTVADDWSLSCASNCTCKWTNGKKSAICSSLQLTTIPNTLSTEL 71
Fly 72 QVLVLNDNHIPYLNREEFSTLGLLNLQRIYLKKSEVQYIHKESFRNLKILVEIDLSDNK-LEMLD 135
Fly 136 KDTFMGNDRLRI------------------------------------------------LYLNG 152
Fly 153 NPLKRLAAYQFPILPHLRTLDMHDCLISYIDPMSLANLNLLEFLNLKNNLLESLSEYVFQHMANL 217
Fly 218 KTLSLEENPWQCNCKLRKFRGWYVNSRLSSVSLVCKGPPAQKDRTWDSVDDELF-GCPP 275 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kek6 | NP_001263151.1 | leucine-rich repeat | 71..96 | CDD:275380 | 7/24 (29%) |
| LRR_8 | 96..155 | CDD:290566 | 25/107 (23%) | ||
| leucine-rich repeat | 97..120 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 121..144 | CDD:275380 | 12/23 (52%) | ||
| LRR_4 | 144..186 | CDD:289563 | 13/89 (15%) | ||
| leucine-rich repeat | 145..168 | CDD:275380 | 9/70 (13%) | ||
| leucine-rich repeat | 169..216 | CDD:275380 | 12/46 (26%) | ||
| LRRCT | 225..274 | CDD:214507 | 16/49 (33%) | ||
| Ig | 295..367 | CDD:143165 | |||
| Rtn4rl2 | NP_852045.1 | LRR_8 | 60..117 | CDD:290566 | 19/60 (32%) |
| LRR 1 | 61..82 | 7/20 (35%) | |||
| leucine-rich repeat | 62..83 | CDD:275380 | 7/24 (29%) | ||
| LRR 2 | 83..104 | 5/20 (25%) | |||
| leucine-rich repeat | 84..107 | CDD:275380 | 6/22 (27%) | ||
| LRR_RI | 103..>261 | CDD:238064 | 39/157 (25%) | ||
| LRR 3 | 107..129 | 11/21 (52%) | |||
| LRR_8 | 108..167 | CDD:290566 | 14/58 (24%) | ||
| leucine-rich repeat | 108..132 | CDD:275380 | 12/23 (52%) | ||
| LRR 4 | 132..153 | 2/20 (10%) | |||
| leucine-rich repeat | 133..156 | CDD:275380 | 1/22 (5%) | ||
| LRR_8 | 156..215 | CDD:290566 | 11/58 (19%) | ||
| LRR 5 | 156..177 | 0/20 (0%) | |||
| leucine-rich repeat | 157..180 | CDD:275380 | 0/22 (0%) | ||
| LRR 6 | 180..201 | 7/20 (35%) | |||
| leucine-rich repeat | 181..204 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 204..262 | CDD:290566 | 15/57 (26%) | ||
| LRR 7 | 204..225 | 3/20 (15%) | |||
| leucine-rich repeat | 205..228 | CDD:275380 | 4/22 (18%) | ||
| LRR 8 | 228..249 | 8/20 (40%) | |||
| leucine-rich repeat | 229..252 | CDD:275380 | 8/22 (36%) | ||
| TPKR_C2 | 261..311 | CDD:301599 | 16/49 (33%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 286..390 | 9/27 (33%) | |||
| Important for interaction with MAG. /evidence=ECO:0000269|PubMed:19420245 | 315..327 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||