DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek6 and Amigo2

DIOPT Version :9

Sequence 1:NP_001263151.1 Gene:kek6 / 43729 FlyBaseID:FBgn0039862 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_877968.3 Gene:Amigo2 / 300186 RGDID:727911 Length:520 Species:Rattus norvegicus


Alignment Length:489 Identity:113/489 - (23%)
Similarity:179/489 - (36%) Gaps:127/489 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PRTL-PVCWILLCL--VAWTVADDWSLSCASNCTCKWTNGKKSAICSSLQLTTIPNTL------- 67
            ||.: |.|..||||  :|..|:...|..|.:.|.|    ......|::..|:.:|..|       
  Rat    12 PRAVKPGCRELLCLLVIAVMVSPSSSGLCPTACIC----ATDIVSCTNKNLSKVPGNLFRLIKRL 72

  Fly    68 ------------------STELQVLVLNDNHIPYLNREEFSTLGLLNLQRIYLKKSEVQYIHKES 114
                              ..:|..|::..|:|..::...|||..  ||:.:.|..:.::.:....
  Rat    73 DLSYNRIGLLDADWIPVSFVKLSTLIVRHNNITSISTGSFSTTP--NLKCLDLSSNRLKSVKSAM 135

  Fly   115 FRNLKILVEIDLSDNKLEMLDKDTFMGNDRLRILYLNGNPLKRLAAYQFPILPHLRTLDMHDCLI 179
            |:.||:|..:.|.:|.:..||...|.|...|:.|||:||.|.:     ||       :|:     
  Rat   136 FQELKVLEVLLLYNNHISYLDPAAFGGLSHLQKLYLSGNFLTK-----FP-------MDL----- 183

  Fly   180 SYIDPMSLANLNLLEFLNLKNNLLESLSEYVFQHMAN------LKTLSLEENPWQCNCKLRKFRG 238
             |:....||:|.   ||::..|.:.|:.    .|..|      |:.:.|..||:.|:|.|.....
  Rat   184 -YVGRFKLADLT---FLDVSYNQIASIP----MHHINLVPGKQLRGIFLHGNPFVCDCSLYSLLT 240

  Fly   239 WYVNSRLSSVS-----LVCKGPPAQKDRTW-DS--------VDDELFGCPPRVEIFNNE-----E 284
            ::.....:||:     ..|        |.| ||        :.|....|..  .:.|..     .
  Rat   241 FWYRRHFNSVTDFKHDYTC--------RLWLDSRHSHQLLLLQDSFLNCSH--SVINGSFHALGF 295

  Fly   285 VQNIDIGSNTTFSCLVYGDPLPEVAWELNGKILDNDNVLF-----ESESIASDKLWSNLTVFNVT 344
            :....:|......|              :|| ..|.|..|     ::..:..||...|..||...
  Rat   296 IHEAQVGERAIVHC--------------DGK-TGNGNTDFIWVGPDNRLLEPDKDTGNFRVFYNG 345

  Fly   345 SL--------DAGTYACTGSN--SIGSMTQNISIYLSEIVQHVLEKTPETF--WYFGLIMGIFGT 397
            ||        |||.|:|...|  .:.:.|.:|.|.:|....:......|.|  .:..|...:...
  Rat   346 SLVIENPGFEDAGVYSCIAMNRQRLLNETVDIMINVSNFTINRSHHAHEAFNTAFTTLAACVVSI 410

  Fly   398 VFLLISISFVVCLCK-RTTRQHRHANKAGVKSSV 430
            |.:|:.:....|.|| |..||....|::...||:
  Rat   411 VLVLLYLYLTPCPCKCRDKRQKNALNQSNAHSSI 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek6NP_001263151.1 leucine-rich repeat 71..96 CDD:275380 7/24 (29%)
LRR_8 96..155 CDD:290566 19/58 (33%)
leucine-rich repeat 97..120 CDD:275380 4/22 (18%)
leucine-rich repeat 121..144 CDD:275380 7/22 (32%)
LRR_4 144..186 CDD:289563 11/41 (27%)
leucine-rich repeat 145..168 CDD:275380 9/22 (41%)
leucine-rich repeat 169..216 CDD:275380 10/46 (22%)
LRRCT 225..274 CDD:214507 13/62 (21%)
Ig 295..367 CDD:143165 20/86 (23%)
Amigo2NP_877968.3 leucine-rich repeat 50..71 CDD:275380 4/20 (20%)
LRR <53..>240 CDD:227223 51/213 (24%)
LRR 1 68..89 0/20 (0%)
leucine-rich repeat 72..94 CDD:275380 0/21 (0%)
LRR_8 93..174 CDD:404697 24/82 (29%)
LRR 2 93..114 5/20 (25%)
leucine-rich repeat 96..117 CDD:275380 6/22 (27%)
LRR 3 117..138 4/20 (20%)
leucine-rich repeat 118..141 CDD:275380 4/22 (18%)
LRR 4 141..162 6/20 (30%)
leucine-rich repeat 142..165 CDD:275380 7/22 (32%)
LRR 5 165..186 11/38 (29%)
leucine-rich repeat 166..192 CDD:275380 12/43 (28%)
LRR 6 192..213 6/27 (22%)
leucine-rich repeat 219..231 CDD:275378 4/11 (36%)
ig 297..367 CDD:395002 19/84 (23%)
Ig strand B 304..312 CDD:409353 1/21 (5%)
Ig strand C 319..323 CDD:409353 1/3 (33%)
Ig strand D 325..330 CDD:409353 0/4 (0%)
Ig strand E 338..344 CDD:409353 3/5 (60%)
Ig strand F 358..366 CDD:409353 3/7 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 437..458 2/8 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 498..520
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.