| Sequence 1: | NP_001263151.1 | Gene: | kek6 / 43729 | FlyBaseID: | FBgn0039862 | Length: | 843 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006499655.1 | Gene: | Rtn4rl2 / 269295 | MGIID: | 2669796 | Length: | 480 | Species: | Mus musculus |
| Alignment Length: | 307 | Identity: | 83/307 - (27%) |
|---|---|---|---|
| Similarity: | 126/307 - (41%) | Gaps: | 60/307 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 19 CWILLCLVAWTVADDWSLSCASNCTCKWTNGKKSAICSSLQLTTIPNTLSTELQVLVLNDNHIPY 83
Fly 84 LNREEFSTLGLLNLQRIYLKKSEVQYIHKESFRNLKILVEIDLSDNK-LEMLDKDTFMGNDRLRI 147
Fly 148 ------------------------------------------------LYLNGNPLKRLAAYQFP 164
Fly 165 ILPHLRTLDMHDCLISYIDPMSLANLNLLEFLNLKNNLLESLSEYVFQHMANLKTLSLEENPWQC 229
Fly 230 NCKLRKFRGWYVNSRLSSVSLVCKGPPAQKDRTWDSVDDELF-GCPP 275 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kek6 | NP_001263151.1 | leucine-rich repeat | 71..96 | CDD:275380 | 7/24 (29%) |
| LRR_8 | 96..155 | CDD:290566 | 26/107 (24%) | ||
| leucine-rich repeat | 97..120 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 121..144 | CDD:275380 | 12/23 (52%) | ||
| LRR_4 | 144..186 | CDD:289563 | 13/89 (15%) | ||
| leucine-rich repeat | 145..168 | CDD:275380 | 9/70 (13%) | ||
| leucine-rich repeat | 169..216 | CDD:275380 | 12/46 (26%) | ||
| LRRCT | 225..274 | CDD:214507 | 16/49 (33%) | ||
| Ig | 295..367 | CDD:143165 | |||
| Rtn4rl2 | XP_006499655.1 | leucine-rich repeat | 122..143 | CDD:275380 | 7/24 (29%) |
| LRR_8 | 143..203 | CDD:338972 | 22/59 (37%) | ||
| leucine-rich repeat | 144..167 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 168..192 | CDD:275380 | 12/23 (52%) | ||
| leucine-rich repeat | 193..216 | CDD:275380 | 1/22 (5%) | ||
| LRR_8 | 216..275 | CDD:338972 | 11/58 (19%) | ||
| leucine-rich repeat | 217..240 | CDD:275380 | 0/22 (0%) | ||
| leucine-rich repeat | 241..264 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 264..322 | CDD:338972 | 15/57 (26%) | ||
| leucine-rich repeat | 265..288 | CDD:275380 | 4/22 (18%) | ||
| leucine-rich repeat | 289..312 | CDD:275380 | 8/22 (36%) | ||
| LRRCT | 321..371 | CDD:214507 | 16/49 (33%) | ||
| PHA03247 | 349..>429 | CDD:223021 | 8/24 (33%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||