DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek6 and LRIT1

DIOPT Version :9

Sequence 1:NP_001263151.1 Gene:kek6 / 43729 FlyBaseID:FBgn0039862 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_056428.1 Gene:LRIT1 / 26103 HGNCID:23404 Length:623 Species:Homo sapiens


Alignment Length:397 Identity:102/397 - (25%)
Similarity:164/397 - (41%) Gaps:81/397 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 WTVADDWSLS----CASNCTCK---WTNGKK--SAICSSLQLTTIPNTLSTELQVLVLNDNHIPY 83
            |.:|..|...    |.|.|:|.   ..:|.|  :.:|:...:|..|.::..:             
Human     9 WLLALAWPPQARGFCPSQCSCSLHIMGDGSKARTVVCNDPDMTLPPASIPPD------------- 60

  Fly    84 LNREEFSTLGLLNLQRIYLKKSEVQYIHKESFRNLKILVEIDLSDNKLEMLDKDTFMGNDRLRIL 148
                         ..|:.|:::.::.:..|:||.|..|.::.|..|.|..|:.....|..|||.|
Human    61 -------------TSRLRLERTAIRRVPGEAFRPLGRLEQLWLPYNALSELNALMLRGLRRLREL 112

  Fly   149 YLNGNPLKRLAAYQFPIL---PHLRTLDMHDCLISYIDPMSLANLNLLEFLNLKNNLLESLSEYV 210
            .|.||   ||||:.:..|   |.||.||:....:|.:...:...|..|.||:|.:|.|..|.:.:
Human   113 RLPGN---RLAAFPWAALRDAPKLRLLDLQANRLSAVPAEAARFLENLTFLDLSSNQLMRLPQEL 174

  Fly   211 FQHMANLKT------------LSLEENPWQCNCKL----RKFRGWYVNSRLSSVSLVCKGPPAQK 259
            ....|:|:|            |.|::|||.|:|:|    ....||..|.......|.|..|.:..
Human   175 IVSWAHLETGIFPPGHHPRRVLGLQDNPWACDCRLYDLVHLLDGWAPNLAFIETELRCASPRSLA 239

  Fly   260 DRTWDSVDDELFGCP-----PRVEIFNNEEVQNIDIGSNTTFSCLVYGDPLPEVAW-ELNGKILD 318
            ...:..:  ||..|.     |.|     ..:::: :|......|...|.|.||::| ..||:.| 
Human   240 GVAFSQL--ELRKCQGPELHPGV-----ASIRSL-LGGTALLRCGATGVPGPEMSWRRANGRPL- 295

  Fly   319 NDNVLFESESIASD-KLWSNLTVFNVTSLDAGTYACTGSNSIGSMTQNISIYLSE---IVQHVLE 379
            |..|   .:.::|| ..|:.|.:..|:.||:|.|.|...|.:|:....||:.::|   ..:|  .
Human   296 NGTV---HQEVSSDGTSWTLLGLPAVSHLDSGDYICQAKNFLGASETVISLIVTEPPTSTEH--S 355

  Fly   380 KTPETFW 386
            .:|...|
Human   356 GSPGALW 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek6NP_001263151.1 leucine-rich repeat 71..96 CDD:275380 0/24 (0%)
LRR_8 96..155 CDD:290566 19/58 (33%)
leucine-rich repeat 97..120 CDD:275380 6/22 (27%)
leucine-rich repeat 121..144 CDD:275380 6/22 (27%)
LRR_4 144..186 CDD:289563 18/44 (41%)
leucine-rich repeat 145..168 CDD:275380 11/25 (44%)
leucine-rich repeat 169..216 CDD:275380 13/46 (28%)
LRRCT 225..274 CDD:214507 14/52 (27%)
Ig 295..367 CDD:143165 23/73 (32%)
LRIT1NP_056428.1 LRR 1 60..81 4/46 (9%)
leucine-rich repeat 61..84 CDD:275378 6/22 (27%)
LRR_8 63..143 CDD:290566 29/82 (35%)
LRR 2 84..105 5/20 (25%)
leucine-rich repeat 85..132 CDD:275378 18/49 (37%)
LRR 3 108..129 12/23 (52%)
LRR_8 131..202 CDD:290566 19/70 (27%)
LRR_4 131..171 CDD:289563 13/39 (33%)
LRR 4 132..153 5/20 (25%)
leucine-rich repeat 133..156 CDD:275378 6/22 (27%)
LRR 5 156..177 7/20 (35%)
leucine-rich repeat 157..180 CDD:275378 7/22 (32%)
leucine-rich repeat 181..205 CDD:275378 7/23 (30%)
TPKR_C2 201..>240 CDD:301599 12/38 (32%)
Ig 267..345 CDD:299845 26/81 (32%)
IG_like 267..345 CDD:214653 26/81 (32%)
FN3 431..498 CDD:214495
LRR 6. /evidence=ECO:0000305 571..594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.