DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek6 and lrit3

DIOPT Version :9

Sequence 1:NP_001263151.1 Gene:kek6 / 43729 FlyBaseID:FBgn0039862 Length:843 Species:Drosophila melanogaster
Sequence 2:XP_002934296.2 Gene:lrit3 / 100494489 XenbaseID:XB-GENE-6076513 Length:652 Species:Xenopus tropicalis


Alignment Length:463 Identity:99/463 - (21%)
Similarity:172/463 - (37%) Gaps:110/463 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VCWILLCLVAWTVADDWSLSCASNCTCKW-----TNGKKSAICSSLQLTTIPNTLSTELQVLVLN 77
            :|..:...:...:|......|.|.|||.:     ..|.:|.:|:...:..||..:..:...|.:.
 Frog     1 MCLFIYLYMVTLLAGKLEAFCPSQCTCIFHGRSDGTGSRSVLCNDPDMFDIPVNVPVDTVKLRIE 65

  Fly    78 DNHIPYLNREEFSTLGLLNLQRIYLKKSEVQYIHKESFRNLKILVEIDLSDNKLEMLDKDTFMGN 142
            ...|..:..|.|  ..|::|:.:::..:.:..|...||.|||.|.|:.|..|.:.:.        
 Frog    66 KTVIRKIPTEAF--YYLVDLKYLWVTYNSISSIDSSSFYNLKQLHELRLDGNAISVF-------- 120

  Fly   143 DRLRILYLNGNPLKRLAAYQFPILPHLRTLDMHDCLISYIDPMSLANLNLLEFLNLKNNLLESL- 206
                       |.:.||.     :|.|||||:|:..|:.|...|...|..:.:|:|.:|.|.:| 
 Frog   121 -----------PWESLAE-----MPSLRTLDLHNNKIASIPAESARYLRNITYLDLSSNKLTTLP 169

  Fly   207 -----------------SEYVFQHMANLKTLSLEENPWQCNCKLRKFRGWYVNSRLSSVS----- 249
                             |:.:.|.:    .|.|::|||.|:|::.|.      ..||..:     
 Frog   170 SDLLDIWPPFSDKSLISSDLLTQRV----ILGLQDNPWFCDCRISKL------IELSKTTDPHIT 224

  Fly   250 -----LVCKGPPAQKDRTWDSVDDELFGCPPRVEIFNNEEVQNIDIGSNTTFSCLVYGDPLPEVA 309
                 :||.||.......:..|:.|...| .:..:..:.......:|||....|...|:|.|::.
 Frog   225 FLDSFVVCSGPDTLAGFLFQRVELEQEMC-LKPSVMTSATKITSPLGSNVLLRCDASGNPTPQLL 288

  Fly   310 WELNGKILDNDNVLFESESIASDKLWSNLTVFNVTSLDAGTYACTGSNSIGSMTQNISIYLSEIV 374
            |........|..|:  .|:......||.|::..::..|||.|.|...|..|....:|::      
 Frog   289 WSRTNNSAANYTVV--QETPTDGVRWSILSMNGISYKDAGEYRCKAKNFAGVAEASITV------ 345

  Fly   375 QHVLEKTPETFWYFGLIMGIFGTVFLLISISFVVCLCKRTTRQHRHANKAGVKSSVSFNDQEKKL 439
                           :::|:..|                |...||...:.|.:...:...:.|:.
 Frog   346 ---------------IVVGVVTT----------------TASSHRFDRRLGAEQMSNMQTEAKEE 379

  Fly   440 LDSSVTTT 447
            | |.::||
 Frog   380 L-SKISTT 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek6NP_001263151.1 leucine-rich repeat 71..96 CDD:275380 5/24 (21%)
LRR_8 96..155 CDD:290566 11/58 (19%)
leucine-rich repeat 97..120 CDD:275380 6/22 (27%)
leucine-rich repeat 121..144 CDD:275380 4/22 (18%)
LRR_4 144..186 CDD:289563 12/41 (29%)
leucine-rich repeat 145..168 CDD:275380 3/22 (14%)
leucine-rich repeat 169..216 CDD:275380 17/64 (27%)
LRRCT 225..274 CDD:214507 14/58 (24%)
Ig 295..367 CDD:143165 18/71 (25%)
lrit3XP_002934296.2 leucine-rich repeat 59..82 CDD:275378 5/24 (21%)
LRR <69..>190 CDD:227223 35/146 (24%)
leucine-rich repeat 83..106 CDD:275378 6/22 (27%)
LRR_8 106..165 CDD:404697 21/82 (26%)
leucine-rich repeat 107..130 CDD:275378 7/46 (15%)
leucine-rich repeat 131..154 CDD:275378 10/22 (45%)
leucine-rich repeat 155..168 CDD:275378 4/12 (33%)
Ig_3 255..334 CDD:404760 19/80 (24%)
Ig strand A 255..259 CDD:409353 0/3 (0%)
Ig strand A' 263..267 CDD:409353 0/3 (0%)
Ig strand B 272..280 CDD:409353 2/7 (29%)
Ig strand C 286..292 CDD:409353 1/5 (20%)
Ig strand C' 295..298 CDD:409353 0/2 (0%)
Ig strand E 312..318 CDD:409353 3/5 (60%)
Ig strand F 326..334 CDD:409353 3/7 (43%)
FN3 455..518 CDD:214495
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6815
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.