DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek6 and lrrc4

DIOPT Version :9

Sequence 1:NP_001263151.1 Gene:kek6 / 43729 FlyBaseID:FBgn0039862 Length:843 Species:Drosophila melanogaster
Sequence 2:XP_002939414.1 Gene:lrrc4 / 100493671 XenbaseID:XB-GENE-968937 Length:641 Species:Xenopus tropicalis


Alignment Length:432 Identity:99/432 - (22%)
Similarity:160/432 - (37%) Gaps:99/432 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ILLCLVAWTVADDWS--LSCASNCTCKWTNGKKSAICSSLQLTTIPNTLSTELQVLVLNDNHIPY 83
            |.|.:..|.....:|  .||.|.|:|  :|.....:|:...|:.:|..:.:..:.|.|.:|:|..
 Frog    21 IYLMVHMWISCAAYSGPQSCPSVCSC--SNQFSKVVCTRRGLSEVPQGIPSNTRSLNLMENNIQM 83

  Fly    84 LNREEFSTLGLLNLQRIYLKKSEVQYIHKESFRNLKILVEIDLSDNKLEMLDKDTFMGNDRLRIL 148
            :..:.|..|.  :|:.:.|.::.::.|...:|..|..|..::|.||.|.::....|....:||.|
 Frog    84 IQADTFRHLH--HLEVLQLGRNSIRQIEVGAFNGLASLNTLELFDNWLTVIPSGAFEYLSKLREL 146

  Fly   149 YLNGNPLKRLAAYQFPILPHLRTLDMHDC-LISYIDP------MSLANLNL-------------- 192
            :|..||::.:.:|.|..:|.|..||:.:. .:.||..      .:|..|||              
 Frog   147 WLRNNPIESIPSYAFNRVPSLMRLDLGELKKLEYISEGAFEGLYNLKYLNLGMCNIRDMPNLTPL 211

  Fly   193 -----LEF---------------------------------------------LNLKNNLLESLS 207
                 ||.                                             |||.:|.:.||.
 Frog   212 VGLEELEISGNNFPEIKPGSFHGLRSLKKLWIMNSQINTIERNAFDDLTSLVELNLAHNNVTSLP 276

  Fly   208 EYVFQHMANLKTLSLEENPWQCNCKLRKFRGWYVNSRLSSVSLV---CKGPPAQKDRTWDSVDDE 269
            ..:|..:..|..|.|..|||.|:|.: .:..|::...:.:.|..   |..||..:.:....||..
 Frog   277 HDLFAPLKYLVELHLHHNPWDCDCDV-LWLSWWLREYIPTNSTCCGRCHSPPHMRGKYVVEVDHS 340

  Fly   270 LFGCPPRVEIFNNEEVQNIDIGSNTTFSCLVYGDPLPEVAWELNGKILDNDNVLFESE-----SI 329
            :|.|.... |.:.....||..|......|..  ..:..|.|     :|.|..||..:.     :|
 Frog   341 MFQCSAPF-IMDAPRDLNISEGRMAELKCRT--SAMSSVRW-----LLPNGTVLTHASNHPRITI 397

  Fly   330 ASDKLWSNLTVFNVTSLDAGTYACTGSNSIGSMTQNISIYLS 371
            .:|   ..|....|...|.|.|.|..:|..|:  .|.|.||:
 Frog   398 LND---GTLNFSQVLLTDTGVYTCMVTNVAGN--SNASAYLN 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek6NP_001263151.1 leucine-rich repeat 71..96 CDD:275380 6/24 (25%)
LRR_8 96..155 CDD:290566 16/58 (28%)
leucine-rich repeat 97..120 CDD:275380 5/22 (23%)
leucine-rich repeat 121..144 CDD:275380 6/22 (27%)
LRR_4 144..186 CDD:289563 14/48 (29%)
leucine-rich repeat 145..168 CDD:275380 8/22 (36%)
leucine-rich repeat 169..216 CDD:275380 18/117 (15%)
LRRCT 225..274 CDD:214507 13/51 (25%)
Ig 295..367 CDD:143165 18/76 (24%)
lrrc4XP_002939414.1 LRRNT 40..71 CDD:214470 8/32 (25%)
LRR <68..285 CDD:227223 44/218 (20%)
leucine-rich repeat 71..94 CDD:275380 6/24 (25%)
leucine-rich repeat 95..118 CDD:275380 5/22 (23%)
leucine-rich repeat 119..142 CDD:275380 6/22 (27%)
leucine-rich repeat 143..166 CDD:275380 8/22 (36%)
leucine-rich repeat 167..191 CDD:275380 5/23 (22%)
leucine-rich repeat 192..213 CDD:275380 4/20 (20%)
leucine-rich repeat 214..237 CDD:275380 2/22 (9%)
leucine-rich repeat 238..261 CDD:275380 0/22 (0%)
leucine-rich repeat 262..283 CDD:275380 7/20 (35%)
LRRCT 294..345 CDD:214507 13/51 (25%)
IG_like 353..435 CDD:214653 24/94 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm49155
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.