DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek6 and lrrc4c

DIOPT Version :9

Sequence 1:NP_001263151.1 Gene:kek6 / 43729 FlyBaseID:FBgn0039862 Length:843 Species:Drosophila melanogaster
Sequence 2:XP_002938986.1 Gene:lrrc4c / 100188921 XenbaseID:XB-GENE-5772259 Length:639 Species:Xenopus tropicalis


Alignment Length:623 Identity:130/623 - (20%)
Similarity:224/623 - (35%) Gaps:182/623 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PVCWILLCLVAWTVAD-DWSLSCASNCTCKWTNGKKSAICSSLQLTTIPNTLSTELQVLVLNDNH 80
            |:..:||.|....||. ..:.:|.|.|:|  :|.....||:...|..:|:.:||..:.|.|::|.
 Frog    25 PLFIVLLALQLLVVAGLVRAQTCPSVCSC--SNQFSKVICTRRNLREVPDGISTNTRQLNLHENQ 87

  Fly    81 IPYLNREEFSTLGLLNLQRIYLKKSEVQYIHKESFRNLKILVEIDLSDNKLEMLDKDTFMGNDRL 145
            |..:..:.|.  .|.:|:.:.|.::.::.|...:|..|..|..::|.||:|..:....|....:|
 Frog    88 IQIIKVDSFK--HLRHLEVLQLSRNHIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFEYLSKL 150

  Fly   146 RILYLNGNPLKRLAAYQFPILPHLRTLDMHDC-LISYIDPMSLANLNLLEFLNL----------- 198
            :.|:|..||::.:.:|.|..:|.||.||:.:. .:|||...:...|:.|::|||           
 Frog   151 KELWLRNNPIESIPSYAFNRIPSLRRLDLGEMKRLSYISEGAFEGLSNLKYLNLGMCNLRDIPNL 215

  Fly   199 ------------KNNL----------------------------------LESLSEY-------- 209
                        .|:|                                  |:||.|.        
 Frog   216 TPLVKLDELDLSGNHLSVLRPGSFQGLTHLQKLWIMHSQIQVIERNAFDDLQSLVELNLAHNNLT 280

  Fly   210 -----VFQHMANLKTLSLEENPWQCNCKLRKFRGWYVNSRLSSVSLV---CKGPPAQKDRTWDSV 266
                 :|..:.||:.:.|..|||.|||.: .:..|::...:::.|..   |..||:.|......:
 Frog   281 LLPHDLFTPLHNLQRIQLHHNPWNCNCDI-LWLSWWLKEIVTTGSTCCARCSTPPSLKGTHIAEL 344

  Fly   267 DDELFGCPPRVEIFNNEEVQNIDIGSNTTFSCLVYGDPLPEVAW-ELNGKILDNDNVLFESESIA 330
            |...|.|...|.:....:: |:..|......|.. ...|..|:| ..||.|:.:.:..... |:.
 Frog   345 DHNYFTCYAPVIVEPPADL-NVTEGMAAELKCRA-STSLTYVSWITPNGTIMTHGSYKVRI-SVL 406

  Fly   331 SDKLWSNLTVFNVTSLDAGTYACTGSNSIGSMTQNISI----------YLSEIVQHVLE------ 379
            :|   ..|...|||..|.|.|.|..|||.|:.|.:.::          |.|.:....:|      
 Frog   407 ND---GTLNFTNVTVRDTGLYTCIVSNSAGNTTASATLNVTASDTGYTYFSTVTVETMEPSQDEA 468

  Fly   380 KTPETFWYFG--------------------------------------------------LIMGI 394
            :|.||  :.|                                                  :|:|.
 Frog   469 RTTET--HVGPTPVIDWETTNATTSLMPQSTRFTEKTVTVPVTDANNGMPGIDEVMKTTKIIIGC 531

  Fly   395 FGTVFLLISISFVVCLCKRTTRQHRHANKAGVKSSVSFNDQEKKLLDSSV--------------- 444
            |..:.|:.::..|: ..|...:.||..:.|..::....|..::...|:.:               
 Frog   532 FVAITLMAAVMLVI-FYKMRKQHHRKNHHAPTRTVEIINVDDELTADTPIESHLPMPAIEHEHLN 595

  Fly   445 -----------TTTTNDRGDSYGIDNQPTSIGMNKGDS 471
                       |||.|.....:...::|..|..|..|:
 Frog   596 HYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRANSKDN 633

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek6NP_001263151.1 leucine-rich repeat 71..96 CDD:275380 6/24 (25%)
LRR_8 96..155 CDD:290566 15/58 (26%)
leucine-rich repeat 97..120 CDD:275380 5/22 (23%)
leucine-rich repeat 121..144 CDD:275380 6/22 (27%)
LRR_4 144..186 CDD:289563 15/42 (36%)
leucine-rich repeat 145..168 CDD:275380 7/22 (32%)
leucine-rich repeat 169..216 CDD:275380 19/117 (16%)
LRRCT 225..274 CDD:214507 14/51 (27%)
Ig 295..367 CDD:143165 22/72 (31%)
lrrc4cXP_002938986.1 LRRNT 47..78 CDD:214470 11/32 (34%)
LRR <77..302 CDD:227223 47/226 (21%)
leucine-rich repeat 78..101 CDD:275380 6/24 (25%)
leucine-rich repeat 102..125 CDD:275380 5/22 (23%)
leucine-rich repeat 126..149 CDD:275380 6/22 (27%)
leucine-rich repeat 150..173 CDD:275380 7/22 (32%)
leucine-rich repeat 174..198 CDD:275380 8/23 (35%)
leucine-rich repeat 199..220 CDD:275380 4/20 (20%)
leucine-rich repeat 221..244 CDD:275380 2/22 (9%)
leucine-rich repeat 245..268 CDD:275380 1/22 (5%)
leucine-rich repeat 269..290 CDD:275380 3/20 (15%)
LRRCT 301..351 CDD:214507 14/50 (28%)
Ig 354..443 CDD:416386 25/94 (27%)
Ig strand A 354..357 CDD:409353 1/2 (50%)
Ig strand A' 361..364 CDD:409353 0/3 (0%)
Ig strand B 370..377 CDD:409353 1/6 (17%)
Ig strand C 383..388 CDD:409353 2/4 (50%)
Ig strand C' 391..393 CDD:409353 1/1 (100%)
Ig strand D 402..406 CDD:409353 1/4 (25%)
Ig strand E 409..413 CDD:409353 1/3 (33%)
Ig strand F 423..430 CDD:409353 2/6 (33%)
Ig strand G 433..443 CDD:409353 2/9 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm49155
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.