DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1792 and WIP5

DIOPT Version :9

Sequence 1:NP_651878.1 Gene:CG1792 / 43727 FlyBaseID:FBgn0039860 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_175533.1 Gene:WIP5 / 841545 AraportID:AT1G51220 Length:337 Species:Arabidopsis thaliana


Alignment Length:164 Identity:39/164 - (23%)
Similarity:58/164 - (35%) Gaps:40/164 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 GRHFTCPSNFKLHLLRHTGVKSFACDQCSQQFYTATLLRRHQELH----------------AGNA 250
            |.|:..|:..::.:    |...|.|..|.:.|.....::.|...|                .|..
plant   160 GHHYWIPTPSQILI----GPTQFTCPLCFKTFNRYNNMQMHMWGHGSQYRKGPESLRGTQPTGML 220

  Fly   251 LFQCRYCEATYSNASGRIQHER--------------MRHTNVKPFTCKECNKSFAMSGKLRTHML 301
            ...|..|.....|   .|.|.|              .|....|||.|:.|.|:||:.|..|||. 
plant   221 RLPCFCCAPGCKN---NIDHPRAKPLKDFRTLQTHYKRKHGSKPFACRMCGKAFAVKGDWRTHE- 281

  Fly   302 SHTGVRAFHCDSCQVSFVRRSHLTSHYRSKGHAH 335
            .:.| :.::| ||...|..:..|..|.::.|:.|
plant   282 KNCG-KLWYC-SCGSDFKHKRSLKDHVKAFGNGH 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1792NP_651878.1 zf-AD 6..80 CDD:214871
C2H2 Zn finger 198..218 CDD:275368 3/15 (20%)
C2H2 Zn finger 226..243 CDD:275368 3/16 (19%)
C2H2 Zn finger 254..275 CDD:275368 6/34 (18%)
zf-C2H2 281..303 CDD:278523 10/21 (48%)
C2H2 Zn finger 283..303 CDD:275368 9/19 (47%)
zf-H2C2_2 296..320 CDD:290200 8/23 (35%)
C2H2 Zn finger 311..329 CDD:275368 6/17 (35%)
WIP5NP_175533.1 SFP1 <71..234 CDD:227516 14/80 (18%)
C2H2 Zn finger 180..200 CDD:275368 4/19 (21%)
C2H2 Zn finger 264..280 CDD:275368 7/15 (47%)
C2H2 Zn finger 290..307 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.