DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1792 and WIP3

DIOPT Version :9

Sequence 1:NP_651878.1 Gene:CG1792 / 43727 FlyBaseID:FBgn0039860 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_172306.1 Gene:WIP3 / 837349 AraportID:AT1G08290 Length:337 Species:Arabidopsis thaliana


Alignment Length:279 Identity:69/279 - (24%)
Similarity:104/279 - (37%) Gaps:65/279 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 TEIEVIDLLPEEHLLEETEEPYEICEQNEQPQVKVPAQEKKLRRSTKTTPTVFTSVKFADNSQAT 172
            |.|:.:.||  ..|:|...:..:|.|:|:...|.:.....|..|.:.           .|.|..|
plant    70 TSIQCLPLL--NKLMENNSQASDIKEENKDDVVTLQIGFPKYHRGSS-----------EDGSDIT 121

  Fly   173 RTQWSR-----LTEDEVVALKRERRKR------DCICEQCGRHFTCPSNFKLHLLRHTGVKSFAC 226
            .....:     :.||.||.:|:.|:.:      |...|.||:.|..||..::|:    |...|||
plant   122 FDHQKKPIKREIIEDGVVMMKKRRKMKFDEEIIDSDVEVCGKRFWIPSPAQIHV----GPMQFAC 182

  Fly   227 DQCSQQFYTATLLRRHQELHAGN---------------ALFQ--CRYCEATYSNASGRIQHER-- 272
            ..||:.|.....::.|...|...               |:.:  | ||.|  ......|.|.|  
plant   183 SICSKTFNRYNNMQMHMWGHGSEFRKGADSLKGTIQPAAILRLPC-YCCA--EGCKNNINHPRSK 244

  Fly   273 ------------MRHTNVKPFTCKECNKSFAMSGKLRTHMLSHTGVRAFHCDSCQVSFVRRSHLT 325
                        .|....|||:|.:|.|:.|:.|..|||. .:.| :.::| :|...|..:..|.
plant   245 PLKDFRTLQTHYKRKHGSKPFSCGKCGKALAVKGDWRTHE-KNCG-KLWYC-TCGSDFKHKRSLK 306

  Fly   326 SHYRSKGHAHTSSAQAALD 344
            .|.||.|..|:.......|
plant   307 DHIRSFGSGHSPHPSLLFD 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1792NP_651878.1 zf-AD 6..80 CDD:214871
C2H2 Zn finger 198..218 CDD:275368 7/19 (37%)
C2H2 Zn finger 226..243 CDD:275368 4/16 (25%)
C2H2 Zn finger 254..275 CDD:275368 7/34 (21%)
zf-C2H2 281..303 CDD:278523 9/21 (43%)
C2H2 Zn finger 283..303 CDD:275368 8/19 (42%)
zf-H2C2_2 296..320 CDD:290200 7/23 (30%)
C2H2 Zn finger 311..329 CDD:275368 5/17 (29%)
WIP3NP_172306.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_120097
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.950

Return to query results.
Submit another query.