DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1792 and ZNF398

DIOPT Version :9

Sequence 1:NP_651878.1 Gene:CG1792 / 43727 FlyBaseID:FBgn0039860 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_011514741.1 Gene:ZNF398 / 57541 HGNCID:18373 Length:647 Species:Homo sapiens


Alignment Length:448 Identity:99/448 - (22%)
Similarity:140/448 - (31%) Gaps:175/448 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LPPFICS-----PCELDLQTAIAFR----ERVIRTQKTLQESPNLGNAELIESFAVGVEKEIQYA 104
            |||.|..     |...| ..:|.|.    |::...||.|.::...||.|.:    :.::..|...
Human   135 LPPGIKGDIPKVPVAFD-DVSIYFSTPEWEKLEEWQKELYKNIMKGNYESL----ISMDYAINQP 194

  Fly   105 EEVTEIEVIDLLPE-EHLLEE-------------TEEP-------YEICEQNEQPQVKVPAQEK- 147
            :.:::|:     || ||..|:             :|||       ....:|.|:|||..|.:.| 
Human   195 DVLSQIQ-----PEGEHNTEDQAGPEESEIPTDPSEEPGISTSDILSWIKQEEEPQVGAPPESKE 254

  Fly   148 -------------------------------------------------KLRRSTKTTP--TVFT 161
                                                             |.::||..||  ...|
Human   255 SDVYKSTYADEELVIKAEGLARSSLCPEVPVPFSSPPAAAKDAFSDVAFKSQQSTSMTPFGRPAT 319

  Fly   162 SVKFADNSQATRTQ--------------------WSRLTEDEVVALK-RERRKRDCICEQCGRHF 205
            .:..|...|.|.||                    ...|::|.::..: ....:....|.||.:||
Human   320 DLPEASEGQVTFTQLGSYPLPPPVGEQVFSCHHCGKNLSQDMLLTHQCSHATEHPLPCAQCPKHF 384

  Fly   206 T---------------------------------------------------CPSNF------KL 213
            |                                                   ||..|      ..
Human   385 TPQADLSSTSQDHASETPPTCPHCARTFTHPSRLTYHLRVHNSTERPFPCPDCPKRFADQARLTS 449

  Fly   214 HLLRHTGVKSFACDQCSQQFYTATLLRRHQELHAGNALFQCRYCEATYSNASGRIQHERMRHTNV 278
            |...|...:.|.|.||.:.|.....|..||..||....|.|..|...::..|..|:|: |.||..
Human   450 HRRAHASERPFRCAQCGRSFSLKISLLLHQRGHAQERPFSCPQCGIDFNGHSALIRHQ-MIHTGE 513

  Fly   279 KPFTCKECNKSFAMSGKLRTHMLSHTGVRAFHCDSCQVSFVRRSHLTSHYRSKGHAHT 336
            :|:.|.:|:|||.....|..|...|||.|.|.|..|..||:|:.||..|.|    .||
Human   514 RPYPCTDCSKSFMRKEHLLNHRRLHTGERPFSCPHCGKSFIRKHHLMKHQR----IHT 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1792NP_651878.1 zf-AD 6..80 CDD:214871 12/39 (31%)
C2H2 Zn finger 198..218 CDD:275368 10/76 (13%)
C2H2 Zn finger 226..243 CDD:275368 5/16 (31%)
C2H2 Zn finger 254..275 CDD:275368 6/20 (30%)
zf-C2H2 281..303 CDD:278523 7/21 (33%)
C2H2 Zn finger 283..303 CDD:275368 7/19 (37%)
zf-H2C2_2 296..320 CDD:290200 11/23 (48%)
C2H2 Zn finger 311..329 CDD:275368 8/17 (47%)
ZNF398XP_011514741.1 DUF3669 62..117 CDD:289202
KRAB 148..206 CDD:214630 14/67 (21%)
KRAB_A-box 148..187 CDD:143639 10/43 (23%)
COG5048 <349..593 CDD:227381 56/224 (25%)
C2H2 Zn finger 377..397 CDD:275368 6/19 (32%)
C2H2 Zn finger 405..425 CDD:275368 0/19 (0%)
C2H2 Zn finger 434..454 CDD:275368 4/19 (21%)
C2H2 Zn finger 462..482 CDD:275368 7/19 (37%)
C2H2 Zn finger 490..510 CDD:275368 6/20 (30%)
zf-H2C2_2 502..525 CDD:290200 9/23 (39%)
C2H2 Zn finger 518..538 CDD:275368 7/19 (37%)
zf-H2C2_2 530..555 CDD:290200 11/24 (46%)
zf-C2H2 544..566 CDD:278523 10/25 (40%)
C2H2 Zn finger 546..566 CDD:275368 9/23 (39%)
zf-H2C2_2 558..583 CDD:290200 6/14 (43%)
C2H2 Zn finger 574..592 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.