DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1792 and trem

DIOPT Version :9

Sequence 1:NP_651878.1 Gene:CG1792 / 43727 FlyBaseID:FBgn0039860 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_650861.1 Gene:trem / 42392 FlyBaseID:FBgn0038767 Length:439 Species:Drosophila melanogaster


Alignment Length:442 Identity:103/442 - (23%)
Similarity:161/442 - (36%) Gaps:121/442 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CRTCGLFIFCSTPS-------NLFEEPNSVMLHQ-IEVLTGLFLLGGP---GNELPPFICSPCEL 59
            ||.|     .:.||       ::|.|..|..|.| :.:..|:     |   .:..|..:||.|..
  Fly    12 CRVC-----LNNPSEGEELLHDIFSETASTRLDQMLHICAGI-----PVSLDDNFPDKMCSKCVR 66

  Fly    60 DLQTAIAFRERVIRTQKTL-----QESPN---LGNAELI---------------ESFA------- 94
            .|:....||....|:.:.:     :|:.|   .|..:|:               |.:|       
  Fly    67 CLRLCYKFRLTCQRSHQHIMDMLDREASNANAAGEGDLLSIAEDLSVESVLKSWEDYASQLDGGM 131

  Fly    95 ----------------------------------VGVEKEIQYAEEVTEIEVIDLLPEEHLLE-- 123
                                              ..|..||:.||...|.|..:||..|:..|  
  Fly   132 KVEGEEDQQHQVITYVVEDGDTDDTNMFDVHDPTQPVPNEIEEAETYAEYEEYELLTNENSPEIA 196

  Fly   124 ----------ETEEP--YEICE---QNEQPQVKVPAQEKKLRRSTKTTPTVFTSVKFADNSQATR 173
                      .||||  .||.|   .:::......|:.:|..||.:      ..|.:..||....
  Fly   197 QEKGSTGTDVATEEPPEEEIAEDILDSDEDYDPTHAKPEKCDRSGR------KPVAYHKNSPKVE 255

  Fly   174 TQWSRLTEDEVVALKRERRKRDCICEQCGRHFTCPSNFKLHLLRHTGVKSFACDQCSQQFYTATL 238
            |...:      |..|...:....||:.||..:...:....|:..|:|||...|:.|.:.|.....
  Fly   256 TFKKK------VGRKPRNKLSTYICDVCGNIYPTQARLTEHMKFHSGVKPHECEICGRGFVQNQQ 314

  Fly   239 LRRHQELHAGNALFQCRYCEATYSNASGRIQHERMRHTNVKPFTCKECNKSFAMSGKLRTHMLSH 303
            |.||...|.||..::|.||.|.:::.|.:.:|.|: ||..:|:.|..|:::|..|..|:.|.:.|
  Fly   315 LVRHMNTHTGNRPYKCNYCPAAFADRSTKTKHHRI-HTKERPYVCDVCSRTFTYSDNLKFHKMIH 378

  Fly   304 TGVRAFHCDSCQVSFVRRSHLTSHYRSKGHAHTSSAQAALDNPVELDVKASN 355
            ||.:...||.|...||:.      |:.:.|..|.:.:....|..|...||.:
  Fly   379 TGEKPHVCDLCGKGFVKA------YKLRLHRETHNRRITWRNDAEESTKAED 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1792NP_651878.1 zf-AD 6..80 CDD:214871 20/89 (22%)
C2H2 Zn finger 198..218 CDD:275368 4/19 (21%)
C2H2 Zn finger 226..243 CDD:275368 5/16 (31%)
C2H2 Zn finger 254..275 CDD:275368 7/20 (35%)
zf-C2H2 281..303 CDD:278523 6/21 (29%)
C2H2 Zn finger 283..303 CDD:275368 6/19 (32%)
zf-H2C2_2 296..320 CDD:290200 9/23 (39%)
C2H2 Zn finger 311..329 CDD:275368 5/17 (29%)
tremNP_650861.1 zf-AD 11..87 CDD:214871 20/84 (24%)
COG5048 <264..411 CDD:227381 46/153 (30%)
C2H2 Zn finger 274..294 CDD:275368 4/19 (21%)
zf-H2C2_2 287..311 CDD:290200 8/23 (35%)
C2H2 Zn finger 302..322 CDD:275368 6/19 (32%)
zf-H2C2_2 315..338 CDD:290200 10/22 (45%)
C2H2 Zn finger 330..350 CDD:275368 7/20 (35%)
zf-H2C2_2 345..367 CDD:290200 8/22 (36%)
C2H2 Zn finger 358..378 CDD:275368 6/19 (32%)
zf-H2C2_2 370..394 CDD:290200 8/23 (35%)
C2H2 Zn finger 386..406 CDD:275368 7/25 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.