| Sequence 1: | NP_651878.1 | Gene: | CG1792 / 43727 | FlyBaseID: | FBgn0039860 | Length: | 372 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_650429.1 | Gene: | CG6654 / 41831 | FlyBaseID: | FBgn0038301 | Length: | 639 | Species: | Drosophila melanogaster |
| Alignment Length: | 200 | Identity: | 56/200 - (28%) |
|---|---|---|---|
| Similarity: | 86/200 - (43%) | Gaps: | 19/200 - (9%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 132 CEQNEQ-PQVKVPAQEKKLRRSTKTTPTVFTSVKFADNSQATRTQWSRLTEDEVVALKRERRKRD 195
Fly 196 CICEQCGRHFTCPSNFKLHLLRHTGVKSFACDQCSQQFYTATLLRRHQELHAGNALFQCRYCEAT 260
Fly 261 YSNASGRIQHERMRHTNVKPFTCKECNKSFAMSGKLRTHMLSHTGVRAFHCDSCQVSFVRRSHLT 325
Fly 326 SHYRS 330 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG1792 | NP_651878.1 | zf-AD | 6..80 | CDD:214871 | |
| C2H2 Zn finger | 198..218 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 226..243 | CDD:275368 | 5/16 (31%) | ||
| C2H2 Zn finger | 254..275 | CDD:275368 | 5/20 (25%) | ||
| zf-C2H2 | 281..303 | CDD:278523 | 5/21 (24%) | ||
| C2H2 Zn finger | 283..303 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 296..320 | CDD:290200 | 9/23 (39%) | ||
| C2H2 Zn finger | 311..329 | CDD:275368 | 5/17 (29%) | ||
| CG6654 | NP_650429.1 | zf-AD | 6..79 | CDD:285071 | |
| C2H2 Zn finger | 331..354 | CDD:275368 | |||
| COG5048 | <357..570 | CDD:227381 | 54/195 (28%) | ||
| C2H2 Zn finger | 360..380 | CDD:275368 | |||
| C2H2 Zn finger | 385..406 | CDD:275370 | 3/13 (23%) | ||
| C2H2 Zn finger | 414..434 | CDD:275368 | 5/26 (19%) | ||
| zf-H2C2_2 | 427..451 | CDD:290200 | 6/33 (18%) | ||
| C2H2 Zn finger | 442..490 | CDD:275368 | 19/47 (40%) | ||
| C2H2 Zn finger | 470..487 | CDD:275368 | 5/16 (31%) | ||
| zf-H2C2_2 | 482..507 | CDD:290200 | 8/24 (33%) | ||
| C2H2 Zn finger | 498..518 | CDD:275368 | 5/20 (25%) | ||
| zf-H2C2_2 | 510..534 | CDD:290200 | 7/24 (29%) | ||
| C2H2 Zn finger | 526..546 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 539..563 | CDD:290200 | 9/23 (39%) | ||
| C2H2 Zn finger | 554..574 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 582..602 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 84 | 1.000 | Inparanoid score | I1804 |
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.960 | |||||