DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1792 and CG14710

DIOPT Version :9

Sequence 1:NP_651878.1 Gene:CG1792 / 43727 FlyBaseID:FBgn0039860 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_650092.4 Gene:CG14710 / 41393 FlyBaseID:FBgn0037920 Length:415 Species:Drosophila melanogaster


Alignment Length:425 Identity:101/425 - (23%)
Similarity:172/425 - (40%) Gaps:95/425 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CRTC-GLF----IFCSTPSNLF-EEPNSVMLHQIEVLTGLFLLGGPGNELPPFICSPCELDLQTA 64
            ||.| |.|    :.|     || ::..|.:..::|:...:.:...|  :||...|:.|...:|..
  Fly    10 CRICLGDFEESQMIC-----LFGDKGESDLRKKLELCCRIRVRQSP--QLPEKACNSCCEFVQMW 67

  Fly    65 IAFRERVIRTQ----KTLQESP----NLGNAE----LIESFAVGVEKEIQYAEEVTEIEVIDLLP 117
            ..||:..:.:|    .:..|.|    ...:||    |.|:..:.:..|.|..||:|.||..|   
  Fly    68 FNFRQMCLNSQVYWETSSSERPEALAQASDAEYMLYLYENLHLKLGTENQEKEEITAIEEGD--- 129

  Fly   118 EEHLLEETEEPY--------EICEQNEQPQVKVPAQ--------------------EKKLRRSTK 154
             |...::::|..        |..|::|:|..:.|.|                    :|.......
  Fly   130 -EQQEDQSQEVLDFNGFIINESIEEDEEPNTESPEQILISHMDSYVDDQQMEELIDDKGELVEEL 193

  Fly   155 TTPTVFTSVKFADN----SQATRTQWSRLTE----------DEVVALKRE-------------RR 192
            :....|..|::.|.    |.|.....|...:          |..:..||:             :.
  Fly   194 SNANTFYEVEYGDEELLMSSAPSPHPSFKMDKQKPGRPRKPDAELKFKRKDINAKERGNQPKCKE 258

  Fly   193 KRDCICEQCGRHFTCPSNFKLHLLRHTGVKSFACDQCSQQFYTATLLRRHQELHAGNALFQCRYC 257
            :...:|..||..|...|.|..|::.|:..|...|:.|::.|.....||.|...|.|:..::|.||
  Fly   259 EEKFMCILCGNVFYKKSVFTAHMMTHSEYKPHQCEICNKSFRQMGELRAHIRRHTGDRPYKCMYC 323

  Fly   258 EATYSNASGRIQHERMRHTNVKPFTCKECNKSFAMSGKLRTHMLSHTGVRAFHCDSCQVSFVRRS 322
            :..:.:.|.|::|||: |||.:|:.|:||.|:|..:..|:.|:|||:..:.::|..|..||....
  Fly   324 DRHFYDRSERVRHERV-HTNTRPYACQECGKTFTHTAILKNHILSHSAQKNYNCGICCKSFTLLH 387

  Fly   323 HLTSHYRSKGHAHTSSAQAALDNPVELDVKASNGM 357
            .|.:|.::..|.          |.:|..:.:|..|
  Fly   388 QLKAHLQTLTHR----------NKMEQTIPSSPEM 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1792NP_651878.1 zf-AD 6..80 CDD:214871 19/83 (23%)
C2H2 Zn finger 198..218 CDD:275368 7/19 (37%)
C2H2 Zn finger 226..243 CDD:275368 5/16 (31%)
C2H2 Zn finger 254..275 CDD:275368 8/20 (40%)
zf-C2H2 281..303 CDD:278523 8/21 (38%)
C2H2 Zn finger 283..303 CDD:275368 8/19 (42%)
zf-H2C2_2 296..320 CDD:290200 9/23 (39%)
C2H2 Zn finger 311..329 CDD:275368 6/17 (35%)
CG14710NP_650092.4 zf-AD 9..83 CDD:285071 19/79 (24%)
COG5048 <261..395 CDD:227381 45/134 (34%)
C2H2 Zn finger 264..284 CDD:275368 7/19 (37%)
zf-C2H2 290..312 CDD:278523 6/21 (29%)
C2H2 Zn finger 292..312 CDD:275368 6/19 (32%)
zf-H2C2_2 304..327 CDD:290200 8/22 (36%)
C2H2 Zn finger 320..340 CDD:275368 8/20 (40%)
zf-H2C2_2 335..357 CDD:290200 12/22 (55%)
C2H2 Zn finger 348..368 CDD:275368 8/19 (42%)
C2H2 Zn finger 376..395 CDD:275368 6/18 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.