DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1792 and CG31388

DIOPT Version :9

Sequence 1:NP_651878.1 Gene:CG1792 / 43727 FlyBaseID:FBgn0039860 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster


Alignment Length:449 Identity:116/449 - (25%)
Similarity:169/449 - (37%) Gaps:125/449 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CRTCGLFIFCSTPSNLFEEPNSVMLHQIEVLTGLFLLGGPGNELPPFICSPCELDLQTAIAFRER 70
            ||||......:...|||:..:|.:|.|||.||.|.|  ....:||.|:|..|:.|||.||.||..
  Fly     5 CRTCSRMADPAVAKNLFDPSSSSVLRQIETLTNLQL--KEDGKLPRFMCQDCQHDLQIAIDFRRV 67

  Fly    71 VIRTQKTLQESPNLGNAELIESFAVGVEKEIQYAEEVTEIEVIDLLPEEHLLEETEEPYEICEQ- 134
            .|..|            ||:|.....||||.:..|.:.| :.:|..|:|  |.......::.:: 
  Fly    68 CIEAQ------------ELLELQLRQVEKEEEAFESLAE-QWLDDCPDE--LSNLSPVLQLNDRM 117

  Fly   135 ----NEQPQVKVPAQEKKLRRSTKT--------------TPTVFTSVKFA--------------- 166
                :.:||.|...:...::.:|.|              :|.:.|..:.:               
  Fly   118 DFIFDPEPQDKNTDELASIKTTTTTEYMNAYQSVASPQSSPELSTDSQLSNEHFDMGLSPESEPE 182

  Fly   167 ----DNSQATRT--------QWSRLTE----------------------DE----VVALKR---- 189
                ||...:.:        ::..:.|                      ||    ..||.|    
  Fly   183 SEAIDNRDTSSSHTCSKCGLEFENVDELKLHKYHLHDIPPDTKFVCDHCDEGFRSAAALTRHCNM 247

  Fly   190 ----------------------ERRKRDC--------ICEQCGRHFTCPSNFKLHLLRHTGVKSF 224
                                  |..|:.|        :|..||:|.|...|.|.||:||.|.:..
  Fly   248 INLPLTHSCTKCKSQFHNHILLETHKQRCLRPPASQHVCHICGKHLTTAFNLKNHLVRHAGTRRH 312

  Fly   225 ACDQCSQQFYTATLLRRHQELHAGNALFQCRY-CEATYSNASGRIQHERMR-HTNVKPFTCKECN 287
            .|||||..||||..|..||:.|.....:.||| |..|:...|.|..|||:. ..:.:.:.|:.|.
  Fly   313 KCDQCSASFYTAAELCSHQKTHTTERPYICRYNCGKTFRFCSARSMHERVHMDASKRIYQCEYCP 377

  Fly   288 KSFAMSGKLRTHMLSHTGVRAFHCDSCQVSFVRRSHLTSHYRSKGHAHTSSAQAALDNP 346
            ||:....:.|||...|...|...|:.|::||....|..||.:|..|....:...|..:|
  Fly   378 KSYVTPSECRTHQKYHNLTRDHGCEICRISFKTAKHYRSHLKSNAHKTLEARAKAAASP 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1792NP_651878.1 zf-AD 6..80 CDD:214871 30/73 (41%)
C2H2 Zn finger 198..218 CDD:275368 9/19 (47%)
C2H2 Zn finger 226..243 CDD:275368 10/16 (63%)
C2H2 Zn finger 254..275 CDD:275368 10/22 (45%)
zf-C2H2 281..303 CDD:278523 7/21 (33%)
C2H2 Zn finger 283..303 CDD:275368 7/19 (37%)
zf-H2C2_2 296..320 CDD:290200 9/23 (39%)
C2H2 Zn finger 311..329 CDD:275368 7/17 (41%)
CG31388NP_650060.1 zf-AD 4..76 CDD:285071 32/84 (38%)
C2H2 Zn finger 228..254 CDD:275368 5/25 (20%)
C2H2 Zn finger 286..306 CDD:275368 9/19 (47%)
C2H2 Zn finger 314..334 CDD:275368 12/19 (63%)
C2H2 Zn finger 342..363 CDD:275368 10/20 (50%)
C2H2 Zn finger 373..393 CDD:275368 7/19 (37%)
C2H2 Zn finger 401..419 CDD:275368 7/17 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I19075
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.